RPSBLAST alignment of GI: 254780493 and MMDB domain: 2h31_A_90-234

>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 145
 Score =  122 bits (307), Expect = 7e-29
 Identities = 32/167 (19%), Positives = 49/167 (29%), Gaps = 23/167 (13%)

Query: 88  QLQMFPIELIVRGYLAGNTKTSLLTFYKNGKRKIYEYLLPDNMSDNQKLPYPVITPTTKS 147
           Q +  PIE + R    G    S L      K     Y       +          P    
Sbjct: 1   QCEXIPIEWVCRRIATG----SFLKRNPGVK---EGYKFYPPKVELFFKDDANNDPQWSE 53

Query: 148 SESASGCDQPISPNEIIHRGILTRNQWETISSYALSLFERGCKLALENGLILVDSKYEFG 207
            +                  ++ + + +  S    ++FE   K  L     LVD K EFG
Sbjct: 54  EQ-----LIAAKFCFA--GLLIGQTEVDIXSHATQAIFEILEKSWLPQNCTLVDXKIEFG 106

Query: 208 IDKKQNIILADEIHTPDSSRYWEVETYEKSFREGITPIGLDKDFIRN 254
           +D     I+  ++   DS R W      +           DK   R+
Sbjct: 107 VDVTTKEIVLADVIDNDSWRLWPSGDRSQQK---------DKQSYRD 144