Query         gi|254780494|ref|YP_003064907.1| cation diffusion facilitator family transporter, putative [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 314
No_of_seqs    131 out of 2011
Neff          8.3 
Searched_HMMs 39220
Date          Sun May 29 23:25:46 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780494.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK09509 fieF ferrous iron eff 100.0       0       0  388.6  38.6  285    5-310     3-288 (300)
  2 COG0053 MMT1 Predicted Co/Zn/C 100.0       0       0  370.4  37.4  291    1-312     1-293 (304)
  3 COG3965 Predicted Co/Zn/Cd cat 100.0       0       0  360.6  23.5  303    5-314    12-314 (314)
  4 PRK03557 zinc transporter ZitB 100.0       0       0  347.6  32.7  277    9-310    15-293 (312)
  5 pfam01545 Cation_efflux Cation 100.0       0       0  327.2  33.9  267   25-312     2-272 (273)
  6 COG1230 CzcD Co/Zn/Cd efflux s 100.0       0       0  302.3  32.4  282    4-310    13-295 (296)
  7 KOG1485 consensus              100.0 1.5E-43       0  287.0  27.9  285    7-312   109-407 (412)
  8 TIGR01297 CDF cation diffusion 100.0 7.6E-35 1.9E-39  233.4  34.3  277   12-310     2-293 (294)
  9 KOG1482 consensus              100.0 3.6E-35 9.3E-40  235.4  20.3  285    6-311    66-368 (379)
 10 KOG1484 consensus              100.0 2.6E-31 6.6E-36  211.6  27.2  279   11-313    33-351 (354)
 11 KOG1483 consensus              100.0 5.7E-32 1.4E-36  215.7  14.3  263   15-296    11-358 (404)
 12 KOG2802 consensus               99.8 4.7E-19 1.2E-23  136.1  15.0  188    9-208   203-403 (503)
 13 COG0053 MMT1 Predicted Co/Zn/C  98.4 1.3E-05 3.3E-10   53.4  12.9   95   14-124   122-216 (304)
 14 PRK09509 fieF ferrous iron eff  98.3 1.6E-05 4.1E-10   52.8  11.0   60  239-302   225-284 (300)
 15 PRK03557 zinc transporter ZitB  97.6  0.0014 3.5E-08   40.8  10.6   85  202-296   198-283 (312)
 16 pfam01545 Cation_efflux Cation  97.4  0.0069 1.8E-07   36.5  12.2   86  205-297   175-260 (273)
 17 KOG1485 consensus               97.0   0.014 3.5E-07   34.7   9.8  100  126-225   112-211 (412)
 18 COG1230 CzcD Co/Zn/Cd efflux s  96.9   0.024 6.1E-07   33.2  10.5   52    4-55     17-71  (296)
 19 TIGR01297 CDF cation diffusion  95.8    0.13 3.3E-06   28.7  11.6   90   17-120   116-210 (294)
 20 KOG1484 consensus               94.7     0.3 7.8E-06   26.4  10.6   93  134-226    40-132 (354)
 21 COG4956 Integral membrane prot  93.5    0.52 1.3E-05   25.0  14.8  100  128-230    45-144 (356)
 22 PRK08676 hydrogenase membrane   93.4    0.55 1.4E-05   24.8  14.5   28   38-65     55-82  (486)
 23 pfam06570 DUF1129 Protein of u  82.1     3.4 8.6E-05   20.0  10.6  162   22-211    30-193 (206)
 24 PRK02047 hypothetical protein;  80.1       4  0.0001   19.5   6.2   60  224-289    22-81  (91)
 25 PRK06458 hydrogenase 4 subunit  77.0     4.9 0.00013   19.0  15.1   13  199-212   248-260 (491)
 26 pfam04359 DUF493 Protein of un  73.1     6.2 0.00016   18.3   7.0   63  224-296    21-83  (90)
 27 COG4858 Uncharacterized membra  73.0     6.2 0.00016   18.3   9.5  114   99-218   101-215 (226)
 28 PRK10334 mechanosensitive chan  72.8     6.3 0.00016   18.3   9.9   76  233-311   203-282 (285)
 29 COG2151 PaaD Predicted metal-s  66.3     8.7 0.00022   17.4   7.3   33  281-313    64-96  (111)
 30 PRK12665 putative monovalent c  64.1     9.6 0.00024   17.2  13.9   32   10-41    162-193 (524)
 31 TIGR02159 PA_CoA_Oxy4 phenylac  51.3      16  0.0004   15.8   4.0   33  281-313    41-73  (152)
 32 pfam06772 LtrA Bacterial low t  50.2      16 0.00042   15.7  12.8   26  123-148   211-236 (354)
 33 COG4146 Predicted symporter [G  49.8      17 0.00042   15.7   5.8   36   15-52    119-154 (571)
 34 PRK11646 multidrug resistance   47.5      18 0.00046   15.5  22.0   40  195-234   293-333 (400)
 35 PRK00341 hypothetical protein;  46.2      19 0.00048   15.4   6.4   60  224-290    23-82  (91)
 36 pfam02426 MIase Muconolactone   45.4      20  0.0005   15.3   5.9   24  288-311    63-86  (91)
 37 PRK10054 putative MFS-type tra  45.1      20  0.0005   15.3  21.9   39  197-235   296-335 (395)
 38 PRK12664 putative monovalent c  44.5      20 0.00051   15.2  10.4   87    7-98    222-308 (530)
 39 TIGR00906 2A0303 cationic amin  43.3      21 0.00054   15.1   9.7   96   13-125   192-294 (616)
 40 pfam09877 DUF2104 Predicted me  43.1      21 0.00054   15.1   2.5   17   84-100    79-95  (100)
 41 PRK06277 hydrogenase subunit F  42.2      22 0.00056   15.0  15.1   16   43-58     70-85  (479)
 42 PRK10597 DNA damage-inducible   42.1      22 0.00056   15.0   5.6   41  264-307     3-45  (81)
 43 COG4394 Uncharacterized protei  42.1      22 0.00056   15.0   2.9   19  211-229   193-211 (370)
 44 TIGR03221 muco_delta muconolac  42.0      22 0.00056   15.0   5.8   45  252-311    41-85  (90)
 45 PRK05846 NADH dehydrogenase su  41.9      22 0.00056   14.9  12.6   22   43-64     80-101 (495)
 46 PRK08238 hypothetical protein;  40.3      23  0.0006   14.8  15.3   36   72-107   255-291 (481)
 47 PRK04201 zinc transporter ZupT  38.5      25 0.00064   14.6  10.2   26   90-115    38-63  (263)
 48 PRK06525 hydrogenase 4 subunit  38.5      25 0.00064   14.6  14.1   25  195-219   237-261 (480)
 49 KOG2877 consensus               36.5      27 0.00068   14.4   8.4   26   79-105   174-199 (389)
 50 PRK09928 choline transport pro  35.1      28 0.00072   14.3  21.0   14  150-163   425-438 (679)
 51 PRK06473 NAD(P)H-quinone oxido  34.5      29 0.00074   14.2  11.4   22   41-62     75-96  (500)
 52 pfam11654 DUF2665 Protein of u  34.0      24 0.00062   14.7   1.7   18  193-210     4-21  (47)
 53 PRK00907 hypothetical protein;  33.6      30 0.00076   14.1   6.2   61  223-289    22-82  (92)
 54 TIGR03406 FeS_long_SufT probab  33.6      30 0.00076   14.1   7.1   76  232-313    75-160 (174)
 55 pfam02038 ATP1G1_PLM_MAT8 ATP1  33.2      30 0.00077   14.1   3.6   33   77-110     4-36  (51)
 56 PTZ00302 N-acetylglucosamine-p  32.5      31  0.0008   14.0   6.7   63  227-296   538-600 (604)
 57 pfam04219 DUF413 Protein of un  29.3      18 0.00047   15.4   0.4   13   76-88      3-15  (94)
 58 PRK11027 hypothetical protein;  29.2      19 0.00047   15.4   0.4   15   74-88     10-24  (110)
 59 COG0779 Uncharacterized protei  28.6      36 0.00093   13.6   6.6   67  231-300     6-72  (153)
 60 TIGR01187 potA polyamine ABC t  28.4      37 0.00093   13.6   2.8   78  224-311    69-162 (331)
 61 PRK10671 copA copper exporting  27.4      38 0.00097   13.5   7.5   16  252-267   524-539 (834)
 62 PRK07691 putative monovalent c  27.3      38 0.00098   13.5  14.7   26   41-66     74-99  (498)
 63 PRK08667 hydrogenase membrane   26.4      40   0.001   13.4  22.2   94    6-104   289-390 (644)
 64 PRK04998 hypothetical protein;  26.4      40   0.001   13.4   5.8   57  224-289    21-78  (88)
 65 pfam07290 DUF1449 Protein of u  26.1      40   0.001   13.3   8.4   19  212-230   108-126 (202)
 66 COG1292 BetT Choline-glycine b  25.9      41   0.001   13.3  12.9   24  196-219   472-495 (537)
 67 COG0841 AcrB Cation/multidrug   25.1      42  0.0011   13.2   9.9   15  282-296   623-637 (1009)
 68 pfam09580 Spore_YhcN_YlaJ Spor  24.0      44  0.0011   13.1   7.2   67  232-310    68-134 (169)
 69 PRK12704 phosphodiesterase; Pr  23.2      46  0.0012   13.0   5.9   62  233-305   381-445 (455)
 70 TIGR01186 proV glycine betaine  23.1      40   0.001   13.4   1.2   93  212-309    84-190 (372)
 71 PRK08376 putative monovalent c  23.0      46  0.0012   13.0  17.1   24   42-65     82-105 (513)
 72 PRK00092 hypothetical protein;  22.9      46  0.0012   13.0   6.9   64  232-298     3-66  (153)
 73 pfam10934 DUF2634 Protein of u  22.3      48  0.0012   12.9   5.6   49  220-270    53-107 (112)
 74 PRK12705 hypothetical protein;  22.2      48  0.0012   12.9   6.4   63  233-306   410-476 (485)
 75 PRK10524 prpE propionyl-CoA sy  22.1      48  0.0012   12.9   8.3   73  233-307   509-583 (629)
 76 TIGR01009 rpsC_bact ribosomal   22.0      48  0.0012   12.8   6.4   78  230-311    35-116 (217)
 77 PRK00701 manganese transport p  21.9      48  0.0012   12.8  18.1   90   82-172   162-264 (438)
 78 pfam01566 Nramp Natural resist  21.9      48  0.0012   12.8  17.8   91   82-172   110-211 (365)
 79 pfam07690 MFS_1 Major Facilita  21.6      49  0.0013   12.8  22.1   45  196-240   289-334 (345)
 80 TIGR00657 asp_kinases aspartat  21.4      42  0.0011   13.3   1.0   28  285-312   223-252 (504)
 81 PRK11670 putative ATPase; Prov  20.7      51  0.0013   12.7   9.8   36  270-307   332-367 (369)
 82 PRK12667 putative monovalent c  20.6      52  0.0013   12.7  16.6   25   42-66     79-103 (517)
 83 PRK07363 NAD(P)H-quinone oxido  20.3      52  0.0013   12.6  13.3   19  197-215   236-254 (499)
 84 PRK09672 phage exclusion prote  20.2      52  0.0013   12.6   2.8   46  202-247   206-251 (296)

No 1  
>PRK09509 fieF ferrous iron efflux protein F; Reviewed
Probab=100.00  E-value=0  Score=388.60  Aligned_cols=285  Identities=15%  Similarity=0.122  Sum_probs=262.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCC
Q ss_conf             78889988999999999999999999999998379999999999999999999999999982000012037896437520
Q gi|254780494|r    5 KARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFG   84 (314)
Q Consensus         5 ~~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G   84 (314)
                      +...|.-+|+.++++.+|++++++|+++|+++||+||++||+||+.|+.++++++++.++        ++||||++||||
T Consensus         3 ~~~~~~~~raa~~si~~n~~L~i~K~~~g~~sgS~AllADa~hSl~D~~s~~~~l~~~~~--------s~kp~d~~hPyG   74 (300)
T PRK09509          3 QSYARLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIAASLTNLLVVRY--------SLQPADDEHTFG   74 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCCCCCCCH
T ss_conf             489999999999999999999999999999945099999899999999999999999999--------659997779970


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             45689999999999999999999999999851479876511799999999998668899876410357779999999875
Q gi|254780494|r   85 FWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSW  164 (314)
Q Consensus        85 ~~r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~  164 (314)
                      |+|+|++++++.++++++.++++++++++++++|++...+.+++++++++++++..++++.++.+|+.+|+.+++++.|+
T Consensus        75 hgR~E~l~al~~~i~i~~~~~~i~~esi~~l~~p~~~~~~~~~i~v~~~~iv~~~~l~~~~~~~~~~~~S~~l~A~a~h~  154 (300)
T PRK09509         75 HGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMNDPGVGVGVTLVALICTIILVTFQRWVVRKTQSQAVRADMLHY  154 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             87899999999999999999999999999846986466544899999999999999999999986514757677777899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHHHHCC
Q ss_conf             7887421357999999998301344420467998999999999999889999999999953099-789999999997157
Q gi|254780494|r  165 IVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTS-PDLDSQVREALYPIV  243 (314)
Q Consensus       165 ~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~-~~~~~~I~~~i~~~~  243 (314)
                      +.|.++|.++++|+++.++        +++|+||+++++++++++++++++++++.+.|+|.+| ++..++|++.+.++|
T Consensus       155 ~sD~~~s~~vlig~~~~~~--------g~~~~D~i~aliIs~~I~~~~~~l~~es~~~Lld~~~~~e~~~~I~~~i~~~~  226 (300)
T PRK09509        155 QSDVMMNGAILLALGLSWY--------GWHRADALFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWP  226 (300)
T ss_pred             HHHHHHHHHHHHHHHHHHH--------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCC
T ss_conf             9899970099999999995--------83257589999999999999999999999998577999899999999997288


Q ss_pred             CCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             6115100016787046769999999988899861099999999999999865489219999985476
Q gi|254780494|r  244 IRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQK  310 (314)
Q Consensus       244 ~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~  310 (314)
                      ++.++|+  +|++++|++.++|+|+++|+++   +++|.|++.+++|+++++.+|+..+.||.++.+
T Consensus       227 gV~~vh~--lr~r~~G~~~~vd~hI~v~~~l---sv~eaH~I~~~ve~~i~~~~~~~~v~IH~eP~~  288 (300)
T PRK09509        227 GVSGAHD--LRTRQSGPTRFIQLHLEMEDNL---PLVQAHMVADQVEQALLRRFPGSDVIIHQDPCS  288 (300)
T ss_pred             CCCCCEE--EEEEEECCCEEEEEEEEECCCC---CHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCC
T ss_conf             9877026--8989858929999999989799---899999999999999997679981899869998


No 2  
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=370.39  Aligned_cols=291  Identities=19%  Similarity=0.220  Sum_probs=270.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCC
Q ss_conf             97517888998899999999999999999999999837999999999999999999999999998200001203789643
Q gi|254780494|r    1 MQNYKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERY   80 (314)
Q Consensus         1 m~~~~~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~   80 (314)
                      |.+...+.+..+++.++++..|+++++.|+++|+++||.||+|||+||+.|++++++.+++.++        ++||||++
T Consensus         1 ~~~~~~~~~~~~~~~~~sl~~nl~l~~~K~~~g~~~gS~ALlADaihs~~D~~~si~~l~~l~~--------s~kp~d~~   72 (304)
T COG0053           1 LMMEEERLKLVRRAALISLAVNLALALLKLIAGILTGSVALLADAIHSLSDIVASLIVLIGLRI--------SSKPPDRD   72 (304)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCCCC
T ss_conf             9740777999999999999999999999999984036599999999889999999999999999--------55999777


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
Q ss_conf             75204568999999999999999999999999985147987651179999999999866889987641035777999999
Q gi|254780494|r   81 FQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALD  160 (314)
Q Consensus        81 ~p~G~~r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~  160 (314)
                      |||||+|+|++++++.++++++++++++++++.++++|.++....+++.+++++.+.+..+++|.++.+|+.+|+.+.+|
T Consensus        73 HpyGh~k~E~l~sl~~~~~i~~~g~~i~~~a~~~~~~~~~~~~~~~~~~v~l~s~~~~~~l~~~~~~~~kk~~S~aL~Ad  152 (304)
T COG0053          73 HPYGHGKAETLASLIVSILIFAAGFEILLEAIKRLISPQPVEPPLLALGVALISIVIKEALYRYLRRVGKKTNSQALIAD  152 (304)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHH
T ss_conf             99832779999999999999999999999999998167778851789999999999999999999999998288988965


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCHHHHHHHHHHH
Q ss_conf             98757887421357999999998301344420467998999999999999889999999999953-09978999999999
Q gi|254780494|r  161 AKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQ-MTSPDLDSQVREAL  239 (314)
Q Consensus       161 ~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~-~~~~~~~~~I~~~i  239 (314)
                      +.|++.|.++|+++++|++ ..+.+       +||+||++++++++++++++++++|++++.|+| +.||+..++|++++
T Consensus       153 a~h~~sD~~ts~~~lvgl~-~~~~g-------~~~lD~i~a~~I~~~Il~~~~~~~~~s~~~L~d~~~~~~~~~~i~~~i  224 (304)
T COG0053         153 ALHHRSDVLTSLAVLVGLL-GSLLG-------WPWLDPLAALLISLYILKTGFRLFKESVNELMDAALDPEDLEKIRAII  224 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHH-HHHHC-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             6888729999999999999-99928-------398989999999999999999999999999847689989999999998


Q ss_pred             HHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCC-CEEEEEEEECCCCC
Q ss_conf             71576115100016787046769999999988899861099999999999999865489-21999998547655
Q gi|254780494|r  240 YPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGE-ERWLTISFTTQKKW  312 (314)
Q Consensus       240 ~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~-~~~~~i~F~~~~~~  312 (314)
                      .+.+++.++|+++.|  +.|+.+++|+|+++|+++   +++|.|++.+++++++++.+| ..+++||.++..+.
T Consensus       225 ~~~~~V~~v~~lr~R--~~G~~~~id~~i~v~~~l---s~~eah~I~~~ie~~i~~~~~~~~~v~IhveP~~~~  293 (304)
T COG0053         225 LSVPGVKGVHDLRTR--KSGSRIFIDVHIEVDPDL---SLEEAHEIADEVEKRIKKEFPKVADVTIHVEPLGEK  293 (304)
T ss_pred             HCCCCCCCCHHEEEE--EECCEEEEEEEEEECCCC---CHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             466455230101566--658879999999719999---888899999999999997568775289995567520


No 3  
>COG3965 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=360.60  Aligned_cols=303  Identities=40%  Similarity=0.714  Sum_probs=295.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCC
Q ss_conf             78889988999999999999999999999998379999999999999999999999999982000012037896437520
Q gi|254780494|r    5 KARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFG   84 (314)
Q Consensus         5 ~~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G   84 (314)
                      .++...||+.|++|+..+++++..++++|..+||.++..||++|+.|.++..+++++.++..+       +|.|.|||||
T Consensus        12 ~~~~~~eq~~L~~Si~~tvi~A~~GIi~GL~~gS~~IiFDGvYSl~da~mtllsL~vsrli~~-------~p~~~RF~~G   84 (314)
T COG3965          12 SQDSSNEQLYLRISIAGTVIFAAFGIIWGLLSGSMSIIFDGVYSLIDAGMTLLSLLVSRLIAK-------DPRDARFPYG   84 (314)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCHHHHHHHHHHHHHHHHHHHHCC-------CCCCCCCCCC
T ss_conf             133126789999999999999999999999826658886018999999999999999999604-------9975656765


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH
Q ss_conf             45689999999999999999999999999851479876511799999999998668899876410357779999999875
Q gi|254780494|r   85 FWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSW  164 (314)
Q Consensus        85 ~~r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~  164 (314)
                      +..+||+.-.++|.+++..|.|.++.++..++.|+++.++++++.+.++++..|...+|+.+|.+|+.+|+.+++|.++|
T Consensus        85 fwhlEplvL~ing~ll~ll~lyAlinAl~~l~dGGR~v~~~~ai~yt~~s~~~Ca~~~~~~~r~nrr~~s~lIald~kqW  164 (314)
T COG3965          85 FWHLEPLVLAINGTLLALLCLYALINALGSLLDGGREVEPGHAIAYTLVSVTGCAAIAWKLRRLNRRLKSPLIALDTKQW  164 (314)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
T ss_conf             01000057642128999999999999999986398321402889999999999999999997650037884001588899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCC
Q ss_conf             78874213579999999983013444204679989999999999998899999999999530997899999999971576
Q gi|254780494|r  165 IVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVI  244 (314)
Q Consensus       165 ~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~~~~~~I~~~i~~~~~  244 (314)
                      .+|.+.|.++.+|+++++....|.+.|..+|+||+.-.++|++++..++..++.+.++.+..+|.|.+++|+....++..
T Consensus       165 ~Mst~lS~al~VaF~~a~~l~~T~~a~l~~Y~DPmvlaL~~~v~IplPlg~vk~al~eiLlmtP~el~q~ies~~~~~v~  244 (314)
T COG3965         165 LMSTCLSAALFVAFAAAWLLAGTKFAHLVVYADPMVLALVCLVFIPLPLGTVKSALREILLMTPNELQQSIESHAHEIVE  244 (314)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHHHCCCCHHHHHHHHHHEEECCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             99988999999999999986468422530014789999997824624487899999999951937889999999999999


Q ss_pred             CCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCC
Q ss_conf             1151000167870467699999999888998610999999999999998654892199999854765559
Q gi|254780494|r  245 RHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKKWAI  314 (314)
Q Consensus       245 v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~~~~~  314 (314)
                      .++..+++.++.|.||..++|+|..+|+++|.+.+++.|+||+|+++.++.++|++|+|+.||.|+||||
T Consensus       245 k~~f~~~~~yvArVGr~l~IEi~fiip~~~~ar~Ved~d~Irdei~~slg~~g~~rwltvsfT~D~kWa~  314 (314)
T COG3965         245 KYGFPSYHVYVARVGRGLFIEIHFIIPRESDARNVEDWDDIRDEIGQSLGSLGYERWLTVSFTRDEKWAI  314 (314)
T ss_pred             HHCCCHHHHHHHHHCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCC
T ss_conf             8658527889998466228999998277668746336899999998886347867438999853300039


No 4  
>PRK03557 zinc transporter ZitB; Provisional
Probab=100.00  E-value=0  Score=347.62  Aligned_cols=277  Identities=14%  Similarity=0.127  Sum_probs=245.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHH
Q ss_conf             99889999999999999999999999983799999999999999999999999999820000120378964375204568
Q gi|254780494|r    9 KSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHF   88 (314)
Q Consensus         9 ~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~   88 (314)
                      .+.+|.|.+++..|+.++++|+++|+++||+||++||+||+.|+++.++++++.+++        +||||++|||||+|+
T Consensus        15 ~~~~rrl~~a~~l~~~~~v~eii~G~~s~SlALlaDa~H~l~D~~~~~i~l~a~~~a--------~kp~d~~~tyG~~R~   86 (312)
T PRK03557         15 DNNARRLLYAFGVTAGFMLVEVVGGFLSGSLALLADAGHMLTDAAALLFALLAVQFS--------RRPPTIRHTFGWLRL   86 (312)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCHHHHH
T ss_conf             766327799999999999999999998414999999999998999999999999997--------589986578539999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999998514798765117999999999986688998764103577799999998757887
Q gi|254780494|r   89 EPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAG  168 (314)
Q Consensus        89 E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~  168 (314)
                      |.+++++++++++++++++++|+++|+.+|++ .....+++++++++++|...++.+++ +++.+|..+++++.|.+.|.
T Consensus        87 E~laAl~~~i~L~~~~~~i~~eai~rl~~p~~-i~~~~~l~va~~gl~~n~~~~~~l~~-g~~~~s~nl~Aa~lH~~~D~  164 (312)
T PRK03557         87 TTLAAFVNAIALVVITILIVWEAIERFRTPRP-VAGGMMMAIAVAGLLANIFSFWILHH-GSEEKNLNVRAAALHVLGDL  164 (312)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-CCCCHHHHHHHHHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHH
T ss_conf             99999999999999999999999998479877-77603699999999999999999772-24458889999999999789


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH-HHHHHHH-HHCCCCC
Q ss_conf             4213579999999983013444204679989999999999998899999999999530997899-9999999-7157611
Q gi|254780494|r  169 YLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLD-SQVREAL-YPIVIRH  246 (314)
Q Consensus       169 ~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~~~~-~~I~~~i-~~~~~v~  246 (314)
                      +.|++++++.++.++.++.       |+||+.++++++++++++++++|++++.|||++|++++ +++++.+ +++|++.
T Consensus       165 l~Svgviia~i~i~~~g~~-------~~Dpi~si~Ia~~Il~sa~~llr~s~~iLld~~P~~i~~~~i~~~i~~~i~gV~  237 (312)
T PRK03557        165 LGSVGAIIAALIIIWTGWT-------PADPILSILVSVLVLRSAWRLLKDSVNELLEGAPVSLDINELKRRLCREIPEVR  237 (312)
T ss_pred             HHHHHHHHHHHHHHHCCCC-------CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCE
T ss_conf             9999999999999980985-------024798899999999989999999999998269998999999999986089831


Q ss_pred             CCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             5100016787046769999999988899861099999999999999865489219999985476
Q gi|254780494|r  247 GFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQK  310 (314)
Q Consensus       247 ~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~  310 (314)
                      ++||+|+|  +.|++..+++|+++++..      +.+++.+++++.+.++++--+.|++++.+|
T Consensus       238 ~vHdlhvW--~~g~~~~~~~Hv~v~~~~------~~~~i~~~i~~~l~~~~gI~h~TIq~E~~~  293 (312)
T PRK03557        238 NVHHVHVW--MVGEKPVMTLHVQVIPPH------DHDALLDRIQDYLMHHYQIEHATIQMEYQP  293 (312)
T ss_pred             EEEEEEEE--EECCCEEEEEEEEECCCC------CHHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             11245750--677851599999968988------999999999999998569984799413787


No 5  
>pfam01545 Cation_efflux Cation efflux family. Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are thought to be efflux pumps that remove these ions from cells.
Probab=100.00  E-value=0  Score=327.20  Aligned_cols=267  Identities=23%  Similarity=0.287  Sum_probs=241.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999837999999999999999999999999998200001203789643752045689999999999999999
Q gi|254780494|r   25 MASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILICVA  104 (314)
Q Consensus        25 ~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l~~l~~~~~l~~~~  104 (314)
                      +++.|+++|+++||.|+++||+||+.|+.+..+++++.+++        +||||++|||||+|+|++++++.++++++++
T Consensus         2 l~~~~~~~~~~t~S~allada~~sl~D~~~~~~~l~~~~~~--------~k~~~~~~pfG~~r~E~l~~l~~~i~l~~~~   73 (273)
T pfam01545         2 LALAKLAAGLLTGSLALLADALHSLIDLLSSLLALLALRLS--------SRPPDKRHPFGHGRLEVLAALIVSLLLLGVG   73 (273)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             24178899998523999999999999999999999999996--------5999777997088898999999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999998514798765117999999999986688998764103577--79999999875788742135799999999
Q gi|254780494|r  105 LYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIK--SDFIALDAKSWIVAGYLLLAVVIAFLCAM  182 (314)
Q Consensus       105 ~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~--s~~l~~~~~~~~~D~~~s~~v~i~~~~~~  182 (314)
                      +++++++++++++|+++.... ...+.++++++|..++++.++.+++.+  |+.+++++.|++.|.+.|++++++++++.
T Consensus        74 ~~~~~~si~~l~~~~~~~~~~-~~~~~~~~~~i~~~~~~~~~~~~~~~~~~s~~l~a~~~~~~~D~~~s~~~~~~~~~~~  152 (273)
T pfam01545        74 VFILYESIERLISPEEIEPPG-ILLLALISLVVNLLLALYLRRAGRKIGSKSPALRADALHALVDVLGSLAVLIGLLLIL  152 (273)
T ss_pred             HHHHHHHHHHHHHCCCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             999999999998266776137-8999999999999999999987551478998999999999999999989999999999


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHHHHHHHHHHHCCCCCCCEEEEEEEEEECCE
Q ss_conf             83013444204679989999999999998899999999999530997-89999999997157611510001678704676
Q gi|254780494|r  183 LLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSP-DLDSQVREALYPIVIRHGFLDFYTYVTKVGRS  261 (314)
Q Consensus       183 ~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~-~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~  261 (314)
                      +.++       +|+||++++++++++++.+++++|++.++|+|.+|+ +..++|++.+++.+++.++++.++|  +.|++
T Consensus       153 ~~~~-------~~~D~i~~iii~~~ii~~~~~~~~~s~~~Ll~~~~~~~~~~~i~~~i~~~~~v~~v~~~~~~--~~G~~  223 (273)
T pfam01545       153 LTGL-------YIADPLASLLIALLILYTGLRLLKESLSELLGASPDPELVDKIRKALEALPGVLGVHDLRVW--KSGPT  223 (273)
T ss_pred             HCCC-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCCEEEEEEEEE--EECCC
T ss_conf             7196-------77778999999999999999999999999967799867899999999638995034357999--96895


Q ss_pred             EEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCE-EEEEEEECCCCC
Q ss_conf             999999998889986109999999999999986548921-999998547655
Q gi|254780494|r  262 RIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEER-WLTISFTTQKKW  312 (314)
Q Consensus       262 ~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~-~~~i~F~~~~~~  312 (314)
                      +.+|+|+.+|+++   +++|.|++++++++.+++++|+. +++|+++++++.
T Consensus       224 ~~v~v~i~v~~~~---~~~~~~~i~~~i~~~l~~~~~~i~~~~i~~~~~~~~  272 (273)
T pfam01545       224 LLVEIHIEVDPDL---TVEEAHEIADEIEKALKEKFPGIVHVTIHVEPAPEV  272 (273)
T ss_pred             EEEEEEEEECCCC---CHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             9999999989999---899999999999999998689988699981599988


No 6  
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism]
Probab=100.00  E-value=0  Score=302.29  Aligned_cols=282  Identities=18%  Similarity=0.200  Sum_probs=248.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCC
Q ss_conf             17888998899999999999999999999999837999999999999999999999999998200001203789643752
Q gi|254780494|r    4 YKARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQF   83 (314)
Q Consensus         4 ~~~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~   83 (314)
                      +.....+.+|.+++++..|..++++|+++|+++||+||+||+.|++.|+++.++++++.+++        +|+++++|||
T Consensus        13 ~~~~~~~~~r~l~~~~~L~~~f~~iE~i~g~~s~SlaLLADa~Hml~D~~al~lal~A~~~a--------~r~~~~~~Tf   84 (296)
T COG1230          13 HAHDNPRNERRLLIALLLNLAFMLIEIIGGLLTGSLALLADALHMLSDALALLLALIAIKLA--------RRPATKRFTF   84 (296)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCC
T ss_conf             22223057889999999999999999999999656999973777889999999999999984--------1777787773


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
Q ss_conf             04568999999999999999999999999985147987651179999999999866889987641035777999999987
Q gi|254780494|r   84 GFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKS  163 (314)
Q Consensus        84 G~~r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~  163 (314)
                      ||.|+|.|++++++++++..++++++|+++|+.+|++.+. ..++.++.+++++|....+.+++.  +.++..+++...|
T Consensus        85 Gy~R~eiLaa~~nav~Li~~s~~I~~EAi~R~~~P~~i~~-~~ml~va~~GL~vN~~~a~ll~~~--~~~~lN~r~a~LH  161 (296)
T COG1230          85 GYKRLEILAAFLNALLLIVVSLLILWEAIQRLLAPPPIHY-SGMLVVAIIGLVVNLVSALLLHKG--HEENLNMRGAYLH  161 (296)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC-CCHHHHHHHHHHHHHHHHHHHHCC--CCCCCHHHHHHHH
T ss_conf             0768999999999999999999999999999648888886-145999999999999999996078--7434037789999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH-HHHHHHHHHC
Q ss_conf             578874213579999999983013444204679989999999999998899999999999530997899-9999999715
Q gi|254780494|r  164 WIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLD-SQVREALYPI  242 (314)
Q Consensus       164 ~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~~~~-~~I~~~i~~~  242 (314)
                      .+.|.+.|++++++.+.+.+.+|.|       +||+.+++++++++..+++++|++.+.|++++|+..+ +++++.+.+.
T Consensus       162 vl~D~Lgsv~vIia~i~i~~~~w~~-------~Dpi~si~i~~lil~~a~~l~k~s~~iLle~~P~~id~~~~~~~l~~~  234 (296)
T COG1230         162 VLGDALGSVGVIIAAIVIRFTGWSW-------LDPILSIVIALLILSSAWPLLKESLNILLEGVPEGIDIDKVREALLRI  234 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCC-------CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCC
T ss_conf             9999997799999999999938876-------656999999999999799999999999860599866889999998559


Q ss_pred             CCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             76115100016787046769999999988899861099999999999999865489219999985476
Q gi|254780494|r  243 VIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQK  310 (314)
Q Consensus       243 ~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~  310 (314)
                      |++.++||+|+|... +......+|+++++..   +.   +...+++++.+.+.+.--|+|++++...
T Consensus       235 ~~v~~vhdlHvWsi~-~~~~~~t~Hv~v~~~~---~~---~~~~~~~~~~l~~~~~I~hvTiQ~e~~~  295 (296)
T COG1230         235 PGVASVHDLHVWSIT-GGEHALTLHVVVDEVA---DA---DAALDQIVRRLLEKYGIEHVTIQLETEG  295 (296)
T ss_pred             CCCCCEEECCCCCCC-CCCEEEEEEEEECCCC---CH---HHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             974111234537789-9843689999825766---66---8889999999866439636998724788


No 7  
>KOG1485 consensus
Probab=100.00  E-value=1.5e-43  Score=287.02  Aligned_cols=285  Identities=12%  Similarity=0.066  Sum_probs=235.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHH
Q ss_conf             88998899999999999999999999999837999999999999999999999999998200001203789643752045
Q gi|254780494|r    7 RSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFW   86 (314)
Q Consensus         7 ~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~   86 (314)
                      +++.++++.++++.+|+.++++|+++|+.+||+|++||++||+.|.+++++.++..+.+        +|||+.+||||++
T Consensus       109 ~~~~~~~~~~i~l~~Nigl~vaK~~as~~sgS~aIiAsavdSl~Dl~s~fvll~s~~~~--------~k~~~~~YP~G~~  180 (412)
T KOG1485         109 LKNAERRAAWIGLAANIGLAVAKVVASYLSGSMAIIASAVDSLSDLVSGFVLLFSLRAA--------KKKPTYEYPRGRG  180 (412)
T ss_pred             HHCHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCHHHCCCCCC
T ss_conf             42679999999999999999999988884120999998999999999999999999986--------3898211889877


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-------CCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             689999999999999999999999999851479-------87651-1799999999998668899876410357779999
Q gi|254780494|r   87 HFEPMVLAFNSVILICVALYEFLISILNIISGG-------HDINF-EKAVIYSCVASFICLMMGVYENRCNREIKSDFIA  158 (314)
Q Consensus        87 r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~-------~~~~~-~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~  158 (314)
                      |.|+++.+.++.+|..++..++++|...+..|.       ++... ..++...++++....+.++..++.+++.+|..++
T Consensus       181 r~EtvG~i~~S~iMa~agv~ii~sSl~~i~~~~~~~~~~~~~q~~~~~a~~~i~i~is~~~vk~~l~~~c~~~~ns~iv~  260 (412)
T KOG1485         181 RVETVGLIAVSVIMAMAGVQIIWSSLRLIVGPHAIGHHHNPSQLIFINALWLIAIMISAKEVKLRLTLYCAIKTNSNIVR  260 (412)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCHHHHHEEHHHHHHHHHHHHHHHHHHCCCHHHH
T ss_conf             52001299999999999889999867865143212001585664143002031000268889999999988736827899


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCHHHHHHHHH
Q ss_conf             99987578874213579999999983013444204679989999999999998899999999999530-99789999999
Q gi|254780494|r  159 LDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQM-TSPDLDSQVRE  237 (314)
Q Consensus       159 ~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~-~~~~~~~~I~~  237 (314)
                      +.++|++.|+++|..++++..++++++        +|+||++|++++.+++++|++...+++++|.|. +|||..+++..
T Consensus       261 a~A~dHr~D~lTn~vaLva~~la~~~~--------~~lDP~gailVS~~ii~t~~~t~~~~i~~Lvg~~a~pe~L~~~~~  332 (412)
T KOG1485         261 ANAWDHRNDVLTNSVALVAASLAYYYN--------YWLDPIGAILVSTYIIYTGGRTGLENIKELVGRSAPPEYLEIITY  332 (412)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCHHHHHHHEEHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHH
T ss_conf             998887768988899999999877533--------102631333341002434127899889998188899799999999


Q ss_pred             HHHHCC-CCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCE----EEEEEEECCCCC
Q ss_conf             997157-611510001678704676999999998889986109999999999999986548921----999998547655
Q gi|254780494|r  238 ALYPIV-IRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEER----WLTISFTTQKKW  312 (314)
Q Consensus       238 ~i~~~~-~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~----~~~i~F~~~~~~  312 (314)
                      .+.+.. .+..+  .+++.|+.|..+++|+|+++|+++   ++.++|++.|-++++++..+...    |...+|+++|.+
T Consensus       333 ~~l~~~~~i~~i--dtv~~y~~g~~~~Vev~ivl~~~~---~l~~ah~i~E~lq~~ie~l~ever~fvh~d~e~~hr~~~  407 (412)
T KOG1485         333 LILQHGKLIKHI--DTVRAYTFGSHYFVEVHIVLDEDL---SLSVAHDIGETLQKKIELLPEVERAFVHIDYEFLHRPHH  407 (412)
T ss_pred             HHHHHCCCCCCC--EEEEEECCCCEEEEEEEEECCCCC---CCHHHHHHHHHHHHHHHHCCHHEEEEEECCCCCCCCCHH
T ss_conf             998506753234--146532035258999753048887---617877877999999864612204435447534688067


No 8  
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524   Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are considered to be efflux pumps that remove these ions from cells , , however others are implicated in ion uptake . The family has six predicted transmembrane domains. Members of the family are variable in length because of variably sized inserts, often containing low-complexity sequence.; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport, 0016020 membrane.
Probab=100.00  E-value=7.6e-35  Score=233.38  Aligned_cols=277  Identities=19%  Similarity=0.260  Sum_probs=250.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHH
Q ss_conf             89999999999999999999999983799999999999999999999999999820000120378964375204568999
Q gi|254780494|r   12 ESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPM   91 (314)
Q Consensus        12 ~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l   91 (314)
                      ++.+++++..|+.+++.+++.|+.+||.++++|+.|++.|+.+..+.+++.++        ++||+|++|||||+|.|.+
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~g~~~~s~~~~~d~~h~~~d~~~~~~~~~~~~~--------~~~~~~~~~~~G~~~~e~~   73 (294)
T TIGR01297         2 KRALLISLLLNLLLLLVELVGGLLSGSLALLADALHSLSDVLALLIALLALRL--------SEKPPDERHPFGYGRAEVL   73 (294)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HCCCCCCCCCCCHHHHHHH
T ss_conf             31688899999999999999998730478888777889999999999999987--------4157755566532689999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH--HCCCC--CHHHHHHHHHH
Q ss_conf             99999999999999999999998514---7987651179999999999866889987641--03577--79999999875
Q gi|254780494|r   92 VLAFNSVILICVALYEFLISILNIIS---GGHDINFEKAVIYSCVASFICLMMGVYENRC--NREIK--SDFIALDAKSW  164 (314)
Q Consensus        92 ~~l~~~~~l~~~~~~i~~~si~~l~~---~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~--~~~~~--s~~l~~~~~~~  164 (314)
                      ++++.++++...+.++.++++.++.+   |. +.+. .++.....+++.+....++..+.  +++.+  +..++++..|.
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~  151 (294)
T TIGR01297        74 AALLNGLFLVVVALFILYEAIERLLNGHAPE-EIDG-LALIVAGLGLLVNLILALLLLRGHGGHKLGHGSLNLRAAALHV  151 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC-HHHH-HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHH
T ss_conf             9999999999999999999999875002441-1357-8999999999999999999986420221100147899999998


Q ss_pred             HHHHHHHHHHHHHHHHHHHH--HCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCH-HHH-HHHHHHHH
Q ss_conf             78874213579999999983--013444204679989999999999998899999999999530997-899-99999997
Q gi|254780494|r  165 IVAGYLLLAVVIAFLCAMLL--RDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSP-DLD-SQVREALY  240 (314)
Q Consensus       165 ~~D~~~s~~v~i~~~~~~~~--~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~-~~~-~~I~~~i~  240 (314)
                      +.|.+.|.+++++....++.  ++.       |+||+.++.+++++++.++++.+++...|++.+|+ +.+ .++.+.+.
T Consensus       152 ~~d~~~~~~~~~~~~~~~~~~~~~~-------~~d~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~  224 (294)
T TIGR01297       152 LGDLLGSLGVLIGALLIYFGPFGWT-------WADPIAALLISLLILYTAFRLLKESINVLLDGAPPELLDLIEVKKVLL  224 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             8888999999999999874025503-------777899999999999989999999999985103530356999999997


Q ss_pred             -HCCCCCCCEEEEEEEEEECC-EEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCC-C-EEEEEEEECCC
Q ss_conf             -15761151000167870467-69999999988899861099999999999999865489-2-19999985476
Q gi|254780494|r  241 -PIVIRHGFLDFYTYVTKVGR-SRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGE-E-RWLTISFTTQK  310 (314)
Q Consensus       241 -~~~~v~~v~~~~i~~~~~G~-~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~-~-~~~~i~F~~~~  310 (314)
                       +.+++.++|+.+.|  +.|+ ...+++|+.+++..   +.++.|+...++++...+..| + .+.+++.+..+
T Consensus       225 ~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  293 (294)
T TIGR01297       225 LSIPGVKGVHDLHIW--RIGPGKLVLDVHVEVDPDL---DLKEAHDIALEIEREILKRHPFGIEHVTIHVEPLG  293 (294)
T ss_pred             HHCCCCCCHHHHEEE--EECCCCEEEEEEEEECCCC---CHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCC
T ss_conf             515641110221023--2146725789888754643---25678999999999886405665316888740368


No 9  
>KOG1482 consensus
Probab=100.00  E-value=3.6e-35  Score=235.37  Aligned_cols=285  Identities=16%  Similarity=0.186  Sum_probs=250.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCH
Q ss_conf             88899889999999999999999999999983799999999999999999999999999820000120378964375204
Q gi|254780494|r    6 ARSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGF   85 (314)
Q Consensus         6 ~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~   85 (314)
                      ++++..+|-|+.+.+..+.+++.+++.|+.+||+|++.||-|.+.|..+.++++++.|.        +++||+++..|||
T Consensus        66 ~~~~~~~r~L~~~~~l~l~fm~~E~vGg~~a~SLAImTDAaHlLsD~~sf~isl~slw~--------s~~pa~~r~sfG~  137 (379)
T KOG1482          66 AKRRAAERKLSIAAALCLVFMIGEVVGGYKANSLAIMTDAAHLLSDVASFIISLFSLWL--------SSRPATKRMSFGF  137 (379)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCEECCCHHHHHCCHHHHHHHHHHHHHHHHHHH--------CCCCCCCCEECCE
T ss_conf             44366666699999999999999984773100024453446788889999999989987--------0379987231143


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC--CCC----------
Q ss_conf             56899999999999999999999999998514798765117999999999986688998764103--577----------
Q gi|254780494|r   86 WHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNR--EIK----------  153 (314)
Q Consensus        86 ~r~E~l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~--~~~----------  153 (314)
                      +|+|.+++++..+.+..+.+.+++++++++++++.+.+...+++.+.+++++|..+...++...+  +.+          
T Consensus       138 ~R~Evlgal~Sv~~IW~~tgvLV~~Ai~Rl~s~~~ev~g~~m~i~a~~gv~vNiim~~vL~~~~h~h~H~~~~s~g~~h~  217 (379)
T KOG1482         138 HRAEVLGALVSVLLIWVVTGVLVYEAIQRLLSGDYEVNGGIMLITAAVGVAVNIIMGFVLHQSGHGHSHGGSHSHGHSHD  217 (379)
T ss_pred             EHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCEEEEEEEEHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC
T ss_conf             44777778998888887664459987765606750653637998753233344353210114677777888877676555


Q ss_pred             -----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             -----799999998757887421357999999998301344420467998999999999999889999999999953099
Q gi|254780494|r  154 -----SDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTS  228 (314)
Q Consensus       154 -----s~~l~~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~  228 (314)
                           +..+++...|.+.|.+.|.|++++-.++++-+.+      .++||+..++.+.+.+.+..+++|+....|++++|
T Consensus       218 ~~~~~n~nvraAyiHVlGDliQSvGV~iaa~Ii~f~P~~------~i~DpICT~~FSiivl~TT~~i~rd~~~iLmE~~P  291 (379)
T KOG1482         218 HGEELNLNVRAAFVHVLGDLIQSVGVLIAALIIYFKPEY------KIADPICTFVFSIIVLGTTITILRDILGILMEGTP  291 (379)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHEEEEECCCC------EECCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             444433477889999999999988787612257855443------40572454467899998679999999999753897


Q ss_pred             HHHH-HHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             7899-999999971576115100016787046769999999988899861099999999999999865489219999985
Q gi|254780494|r  229 PDLD-SQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFT  307 (314)
Q Consensus       229 ~~~~-~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~  307 (314)
                      .+.+ +.+++.+..+++|..+|++|+|....|. ....+|+.+++..+      .+.+.++....+++.+.-.++|++-+
T Consensus       292 ~~~d~~~~~~~l~~iegV~~VHdLhIWsiTv~k-~~ls~Hv~i~~~ad------~~~vL~~~~~~i~~~~~~~~vTiQie  364 (379)
T KOG1482         292 RNLDFDKVKKGLLSIEGVKAVHDLHIWSITVGK-VALSVHLAIDSEAD------AEEVLDEARSLIKRRYGISHVTIQIE  364 (379)
T ss_pred             CCCCHHHHHHHHHHHCCEEEEEEEEEEEEECCC-EEEEEEEEECCCCC------HHHHHHHHHHHHHHHCCEEEEEEEEC
T ss_conf             657678999877421164688888888774275-57899996168889------89999999999974256589999815


Q ss_pred             CCCC
Q ss_conf             4765
Q gi|254780494|r  308 TQKK  311 (314)
Q Consensus       308 ~~~~  311 (314)
                      ...+
T Consensus       365 ~~~~  368 (379)
T KOG1482         365 PYTE  368 (379)
T ss_pred             CCCC
T ss_conf             8755


No 10 
>KOG1484 consensus
Probab=100.00  E-value=2.6e-31  Score=211.65  Aligned_cols=279  Identities=15%  Similarity=0.209  Sum_probs=220.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHH
Q ss_conf             88999999999999999999999998379999999999999999999999999982000012037896437520456899
Q gi|254780494|r   11 EESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEP   90 (314)
Q Consensus        11 e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~   90 (314)
                      .+|.....+..|+.++.++++.|..++|+++++|++|++.|+.+..+.+++..++        ++|++..||||++|+|.
T Consensus        33 ~sr~if~f~llnl~~~fv~l~y~~~snSlgLiSda~hm~FDctal~~gL~a~~is--------~~~~~~~fsyG~~r~ev  104 (354)
T KOG1484          33 DSRSIFLFLLLNLAFMFVELFYGSWSNSLGLISDAFHMFFDCTALLAGLYASVIS--------KWPANDKFSYGYGRIEV  104 (354)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCCHHHHHH
T ss_conf             1156699999989999999998643671787888999999999998524577874--------17885556742677889


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHH-HHHHHHHHHCCCCC---------------
Q ss_conf             99999999999999999999999851479876511799999999998668-89987641035777---------------
Q gi|254780494|r   91 MVLAFNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLM-MGVYENRCNREIKS---------------  154 (314)
Q Consensus        91 l~~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~-l~~~~~~~~~~~~s---------------  154 (314)
                      ++++.+++++.+.+++++.|+++|+++| ++......+.++..+.++|.. ++.+.+..+...++               
T Consensus       105 LagF~n~vflvl~a~fi~~Es~eRl~~p-pei~t~rllvVS~~gllvnLvGi~aF~h~~~h~hg~~~~s~~~~h~~~~~~  183 (354)
T KOG1484         105 LAGFVNGVFLVLIAFFIFSESVERLFDP-PEIHTNRLLVVSVLGLLVNLVGILAFSHGHAHSHGSHHHSSHSGHLALLFH  183 (354)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHCCCCEEEEEEHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHCCCC
T ss_conf             9999998999999999769999985091-540786168744789999998999731345435678876532221010110


Q ss_pred             ---------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ---------------------99999998757887421357999999998301344420467998999999999999889
Q gi|254780494|r  155 ---------------------DFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAI  213 (314)
Q Consensus       155 ---------------------~~l~~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~  213 (314)
                                           ..+..-..|.+.|.+.|.+++++-.+..+.+|.       ++||+.+++|++.++.+.+
T Consensus       184 ~~~~~~~~~~~~~~~i~g~~~~~m~gifLHVLaDtlgSvGviist~Li~~~gw~-------~aDpicsllIailIf~sv~  256 (354)
T KOG1484         184 SLLGVWDLHHHAHGHIHGHSHENMPGIFLHVLADTLGSVGVIISTLLIKLFGWM-------IADPICSLLIAILIFLSVL  256 (354)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHCCCC-------CHHHHHHHHHHHHHHHHHH
T ss_conf             002443223322245677310026642499999871106999999999961961-------1347999999999999988


Q ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHHH---HCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             999999999953099789999999997---15761151000167870467699999999888998610999999999999
Q gi|254780494|r  214 CTMKSATFEIFQMTSPDLDSQVREALY---PIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIG  290 (314)
Q Consensus       214 ~~~~~~~~~Ll~~~~~~~~~~I~~~i~---~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~  290 (314)
                      +++|++++.||+++||+...++.+.+.   ..+++.++.+.|.|+...|. +...+|+.|.++.+.      ..+.+++.
T Consensus       257 PL~k~s~~iLLq~tPp~~~~~l~~cl~~Is~~~gV~~v~~~hFWt~~~g~-~vGtlhl~V~~dade------~~vl~~V~  329 (354)
T KOG1484         257 PLLKYSGKILLQRTPPHLENSLKQCLRQISTLDGVTSVQNPHFWTLESGS-VVGTLHLQVSSDADE------QSVLAHVT  329 (354)
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHCCCCEEECCCCC-EEEEEEEEEECCCCH------HHHHHHHH
T ss_conf             88998877887429911165899999986454444330467424413884-478999998468636------78999999


Q ss_pred             HHHHHHCCCEEEEEEEECCCCCC
Q ss_conf             99865489219999985476555
Q gi|254780494|r  291 NAIGGLGEERWLTISFTTQKKWA  313 (314)
Q Consensus       291 ~~l~~~~~~~~~~i~F~~~~~~~  313 (314)
                      ++++... ..++|++-+.+.-|-
T Consensus       330 ~~~~~~g-V~~ltvQv~~~~~~~  351 (354)
T KOG1484         330 RKLEDAG-VKDLTVQVEKENSTI  351 (354)
T ss_pred             HHHHHCC-EEEEEEEEECCCCEE
T ss_conf             8887636-438999995242011


No 11 
>KOG1483 consensus
Probab=100.00  E-value=5.7e-32  Score=215.71  Aligned_cols=263  Identities=17%  Similarity=0.179  Sum_probs=212.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99999999999999999999983799999999999999999999999999820000120378964375204568999999
Q gi|254780494|r   15 LKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLA   94 (314)
Q Consensus        15 L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l~~l   94 (314)
                      |..-++.++.++++++..|+.++|+||++|++|++.|.++.++++++.+.++        +.+++++|||+.|.|.++++
T Consensus        11 li~~l~ltiiFfvLEli~gyv~~sLaLiadSfHML~dIiaLivaf~~ik~a~--------~~~~~k~tyGw~rAEilGal   82 (404)
T KOG1483          11 LISVLVLTIIFFVLELITGYVTNSLALIADSFHMLNDIIALIVAFWAIKEAK--------RIPLQKYTYGWARAEILGAL   82 (404)
T ss_pred             EEEHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCHHHHHHHHHH
T ss_conf             5634888898877413002024217777457889999999999999987641--------27610048634399998655


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC------------------------
Q ss_conf             99999999999999999998514798765117999999999986688998764103------------------------
Q gi|254780494|r   95 FNSVILICVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNR------------------------  150 (314)
Q Consensus        95 ~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~------------------------  150 (314)
                      ++++++...++.+..|+++|+++|++..++...+...+++++.|..-++..+..+.                        
T Consensus        83 vN~ifl~alc~~I~~EA~~R~I~p~~i~~P~~vL~vgi~gLi~Nvlg~~lfhdhg~~h~~~~H~h~hg~~~~~~~~~~~~  162 (404)
T KOG1483          83 VNAIFLTALCVSILIEAIERIIEPHHIENPILVLYVGIIGLISNVLGLFLFHDHGHDHGHGVHGHSHGGMKGFIGLNLTH  162 (404)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEHHHHHHHHHHHHHHHEEECCCCCCCCCCCCCCCCCCCCCHHHHCCC
T ss_conf             58899999999999999986417765668501002569999999877652421576667767788877634521331048


Q ss_pred             ---------------------------------C---------------------------CCCHHHHHHHHHHHHHHHH
Q ss_conf             ---------------------------------5---------------------------7779999999875788742
Q gi|254780494|r  151 ---------------------------------E---------------------------IKSDFIALDAKSWIVAGYL  170 (314)
Q Consensus       151 ---------------------------------~---------------------------~~s~~l~~~~~~~~~D~~~  170 (314)
                                                       +                           ..+...+.-+.|.+.|.+.
T Consensus       163 ~~~~~~G~~t~~~~~d~~~~~~p~~~l~~~~~~N~~~~s~pv~~~~S~~r~~~~~~~~e~~~~~lnmhGv~LhvL~Dalg  242 (404)
T KOG1483         163 LHSHAIGCNTLAKQLDTPLGPGPNAHLSGVMSQNLDGSSTPVQNHGSLSRDDAREKTEEKLDRNLNMHGVFLHVLGDALG  242 (404)
T ss_pred             CCHHCCCCCCHHHCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEEECCCCC
T ss_conf             74010477500001356898751555056422377887775315775444630332123220241003502343032446


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHH-HHHHHHHHHCCCCCCCE
Q ss_conf             13579999999983013444204679989999999999998899999999999530997899-99999997157611510
Q gi|254780494|r  171 LLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLD-SQVREALYPIVIRHGFL  249 (314)
Q Consensus       171 s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~~~~~~~~-~~I~~~i~~~~~v~~v~  249 (314)
                      |..++++.+   +++.+.|.| .+|.||+.+++++.+++.+++++.|++...||+.+|..++ +.+++.+.++||+..+|
T Consensus       243 ~I~Vi~~A~---~v~~t~~~~-~~y~DP~lsi~~~~ii~~sa~pl~k~s~liLLq~~P~~i~ld~v~~~l~~~~gv~~vh  318 (404)
T KOG1483         243 SIIVIVSAL---FVYKTEYSW-AYYLDPILSIVLTVIILFSAYPLLKESALILLQTTPGSIDLDIVEKDLLTVPGVISVH  318 (404)
T ss_pred             CEEEEEEEE---EEEECCEEH-HHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCEEEEE
T ss_conf             637899889---999622031-5550736999999999970068888999999874877530999998873576536655


Q ss_pred             EEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             00167870467699999999888998610999999999999998654
Q gi|254780494|r  250 DFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGL  296 (314)
Q Consensus       250 ~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~  296 (314)
                      |+|+|.. .|.++.+.+||.++...      +.-++.+.++..+.+.
T Consensus       319 ~lhvWqL-~~~r~IAt~Hi~~~~p~------~~~~~a~~ir~~fh~~  358 (404)
T KOG1483         319 DLHVWQL-AGSRIIATIHIQIQNPK------EYMKIAEKIRSYFHDQ  358 (404)
T ss_pred             EEEEEEE-CCCEEEEEEEEEECCCH------HHHHHHHHHHHHHHHC
T ss_conf             3432011-36468999999832927------8899999999998855


No 12 
>KOG2802 consensus
Probab=99.83  E-value=4.7e-19  Score=136.11  Aligned_cols=188  Identities=12%  Similarity=0.075  Sum_probs=141.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHH
Q ss_conf             99889999999999999999999999983799999999999999999999999999820000120378964375204568
Q gi|254780494|r    9 KSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHF   88 (314)
Q Consensus         9 ~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~   88 (314)
                      |..+|+..+++..|..-+..|+.+.++|||.+|+|+++||+.|....++..++++.        |+|.||..|||||.+.
T Consensus       203 k~s~rvVatAi~iN~l~~~~Kfg~w~~tgShsmfAEaIHS~aD~~NQ~lLa~Gis~--------S~q~PD~lhPYGYsnm  274 (503)
T KOG2802         203 KGSGRVVATAICINGLNCFFKFGAWIYTGSHSMFAEAIHSLADTCNQLLLALGISK--------SVQTPDPLHPYGYSNM  274 (503)
T ss_pred             CCCCCEEHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH--------CCCCCCCCCCCCCCCH
T ss_conf             57872651688887899999865765426678999999999999989999960243--------0469998787765306


Q ss_pred             HHHHHHHHHHHHHHHH-HHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHH----HHHHHCCCCCHHHHHHHHH
Q ss_conf             9999999999999999-9999999998514798765117999999999986688998----7641035777999999987
Q gi|254780494|r   89 EPMVLAFNSVILICVA-LYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVY----ENRCNREIKSDFIALDAKS  163 (314)
Q Consensus        89 E~l~~l~~~~~l~~~~-~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~----~~~~~~~~~s~~l~~~~~~  163 (314)
                      ..+.+|+.|+-++.+| +-.+|.+++.++||+|+++..|+..+...+++........    .++.+++.+-....--...
T Consensus       275 RyVsSLISgvGIfc~G~GlSiyhGv~gLlhpePi~~l~~ay~il~gSl~~eGasllvAi~evkr~Ak~~gmSi~dYV~~~  354 (503)
T KOG2802         275 RYVSSLISGVGIFCMGCGLSIYHGVMGLLHPEPIESLLWAYCILAGSLVSEGASLLVAINEVKRNAKAKGMSIYDYVMES  354 (503)
T ss_pred             HHHHHHHHCCCEEEECCCCHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHC
T ss_conf             67999973244266426604333002346899995068999999667885433999999999987887498798987606


Q ss_pred             H--------HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             5--------78874213579999999983013444204679989999999999
Q gi|254780494|r  164 W--------IVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFI  208 (314)
Q Consensus       164 ~--------~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~i  208 (314)
                      .        .-|.-.-.|+.++..+..+...+    +.|+.|++++++++.++
T Consensus       355 ~DPs~nvVl~EDtAAVtGv~IAaa~m~lss~t----gnPIyD~~GSivvGaLL  403 (503)
T KOG2802         355 RDPSTNVVLLEDTAAVTGVIIAAACMGLSSIT----GNPIYDSLGSIVVGALL  403 (503)
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHHHHHHHC----CCCCCCCCCHHHHHHHH
T ss_conf             89862389943417888899999988888721----89786542037898888


No 13 
>COG0053 MMT1 Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism]
Probab=98.42  E-value=1.3e-05  Score=53.35  Aligned_cols=95  Identities=15%  Similarity=0.129  Sum_probs=81.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             99999999999999999999998379999999999999999999999999982000012037896437520456899999
Q gi|254780494|r   14 LLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVL   93 (314)
Q Consensus        14 ~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l~~   93 (314)
                      +..++++.+..+...+.-.|.-+||.++.+|+.|...|.++++.++.+.- .               .-+|+..++++++
T Consensus       122 v~l~s~~~~~~l~~~~~~~~kk~~S~aL~Ada~h~~sD~~ts~~~lvgl~-~---------------~~~g~~~lD~i~a  185 (304)
T COG0053         122 VALISIVIKEALYRYLRRVGKKTNSQALIADALHHRSDVLTSLAVLVGLL-G---------------SLLGWPWLDPLAA  185 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHH-H---------------HHHCHHHHHHHHH
T ss_conf             99999999999999999999982889889656888729999999999999-9---------------9928398989999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             9999999999999999999985147987651
Q gi|254780494|r   94 AFNSVILICVALYEFLISILNIISGGHDINF  124 (314)
Q Consensus        94 l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~  124 (314)
                      ++.+++++..++.++.+++..++....+++.
T Consensus       186 ~~I~~~Il~~~~~~~~~s~~~L~d~~~~~~~  216 (304)
T COG0053         186 LLISLYILKTGFRLFKESVNELMDAALDPED  216 (304)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             9999999999999999999998476899899


No 14 
>PRK09509 fieF ferrous iron efflux protein F; Reviewed
Probab=98.30  E-value=1.6e-05  Score=52.76  Aligned_cols=60  Identities=10%  Similarity=-0.081  Sum_probs=23.2

Q ss_pred             HHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
Q ss_conf             9715761151000167870467699999999888998610999999999999998654892199
Q gi|254780494|r  239 LYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWL  302 (314)
Q Consensus       239 i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~  302 (314)
                      ...+.++++++..+.--...- ...++++=.++-.-   ..+..|++++++++++....--+|+
T Consensus       225 ~~gV~~vh~lr~r~~G~~~~v-d~hI~v~~~lsv~e---aH~I~~~ve~~i~~~~~~~~v~IH~  284 (300)
T PRK09509        225 WPGVSGAHDLRTRQSGPTRFI-QLHLEMEDNLPLVQ---AHMVADQVEQALLRRFPGSDVIIHQ  284 (300)
T ss_pred             CCCCCCCEEEEEEEECCCEEE-EEEEEECCCCCHHH---HHHHHHHHHHHHHHHCCCCCEEEEE
T ss_conf             889877026898985892999-99999897998999---9999999999999767998189986


No 15 
>PRK03557 zinc transporter ZitB; Provisional
Probab=97.60  E-value=0.0014  Score=40.84  Aligned_cols=85  Identities=8%  Similarity=-0.030  Sum_probs=51.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHH
Q ss_conf             999999999889999999999953099-7899999999971576115100016787046769999999988899861099
Q gi|254780494|r  202 MFICLFILPSAICTMKSATFEIFQMTS-PDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIA  280 (314)
Q Consensus       202 lii~l~ii~~~~~~~~~~~~~Ll~~~~-~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~  280 (314)
                      +.-+.-+++.+...+-|..+   +... +++.+.+.+.+..+.+++++|...+-....- ..++.+.=.-+.+.      
T Consensus       198 l~sa~~llr~s~~iLld~~P---~~i~~~~i~~~i~~~i~gV~~vHdlhvW~~g~~~~~-~~Hv~v~~~~~~~~------  267 (312)
T PRK03557        198 LRSAWRLLKDSVNELLEGAP---VSLDINELKRRLCREIPEVRNVHHVHVWMVGEKPVM-TLHVQVIPPHDHDA------  267 (312)
T ss_pred             HHHHHHHHHHHHHHHHHCCC---CCCCHHHHHHHHHHCCCCCEEEEEEEEEEECCCEEE-EEEEEECCCCCHHH------
T ss_conf             99899999999999982699---989999999999860898311124575067785159-99999689889999------


Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999998654
Q gi|254780494|r  281 SLDAIRHEIGNAIGGL  296 (314)
Q Consensus       281 e~~~i~~~i~~~l~~~  296 (314)
                      ..+++++.+.++.+-.
T Consensus       268 i~~~i~~~l~~~~gI~  283 (312)
T PRK03557        268 LLDRIQDYLMHHYQIE  283 (312)
T ss_pred             HHHHHHHHHHHHCCCC
T ss_conf             9999999999856998


No 16 
>pfam01545 Cation_efflux Cation efflux family. Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are thought to be efflux pumps that remove these ions from cells.
Probab=97.42  E-value=0.0069  Score=36.54  Aligned_cols=86  Identities=13%  Similarity=0.092  Sum_probs=38.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHH
Q ss_conf             99999988999999999995309978999999999715761151000167870467699999999888998610999999
Q gi|254780494|r  205 CLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDA  284 (314)
Q Consensus       205 ~l~ii~~~~~~~~~~~~~Ll~~~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~  284 (314)
                      +.-+++.+...+-+....  +...+++.+.+++ ...+.++++++-.+.-..... ...++++=.++-. ...  +..++
T Consensus       175 ~~~~~~~s~~~Ll~~~~~--~~~~~~i~~~i~~-~~~v~~v~~~~~~~~G~~~~v-~v~i~v~~~~~~~-~~~--~i~~~  247 (273)
T pfam01545       175 GLRLLKESLSELLGASPD--PELVDKIRKALEA-LPGVLGVHDLRVWKSGPTLLV-EIHIEVDPDLTVE-EAH--EIADE  247 (273)
T ss_pred             HHHHHHHHHHHHHCCCCC--HHHHHHHHHHHHC-CCCCEEEEEEEEEEECCCEEE-EEEEEECCCCCHH-HHH--HHHHH
T ss_conf             999999999999677998--6789999999963-899503435799996895999-9999989999899-999--99999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999986548
Q gi|254780494|r  285 IRHEIGNAIGGLG  297 (314)
Q Consensus       285 i~~~i~~~l~~~~  297 (314)
                      +++++++++....
T Consensus       248 i~~~l~~~~~~i~  260 (273)
T pfam01545       248 IEKALKEKFPGIV  260 (273)
T ss_pred             HHHHHHHHCCCCC
T ss_conf             9999998689988


No 17 
>KOG1485 consensus
Probab=96.95  E-value=0.014  Score=34.69  Aligned_cols=100  Identities=10%  Similarity=-0.053  Sum_probs=82.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHH
Q ss_conf             79999999999866889987641035777999999987578874213579999999983013444204679989999999
Q gi|254780494|r  126 KAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFIC  205 (314)
Q Consensus       126 ~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~  205 (314)
                      .....+.+++.+|.++..-+...+---+|.++.+++.|...|.++++...+....+.-.+..-+.++..=..|++.+.++
T Consensus       112 ~~~~~~~i~l~~Nigl~vaK~~as~~sgS~aIiAsavdSl~Dl~s~fvll~s~~~~~k~~~~~YP~G~~r~EtvG~i~~S  191 (412)
T KOG1485         112 AERRAAWIGLAANIGLAVAKVVASYLSGSMAIIASAVDSLSDLVSGFVLLFSLRAAKKKPTYEYPRGRGRVETVGLIAVS  191 (412)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCCHHHHHHH
T ss_conf             79999999999999999999988884120999998999999999999999999986389821188987752001299999


Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999889999999999953
Q gi|254780494|r  206 LFILPSAICTMKSATFEIFQ  225 (314)
Q Consensus       206 l~ii~~~~~~~~~~~~~Ll~  225 (314)
                      .+|...+..+++++...+.+
T Consensus       192 ~iMa~agv~ii~sSl~~i~~  211 (412)
T KOG1485         192 VIMAMAGVQIIWSSLRLIVG  211 (412)
T ss_pred             HHHHHHHHHHHHHHHHHHHC
T ss_conf             99999988999986786514


No 18 
>COG1230 CzcD Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism]
Probab=96.86  E-value=0.024  Score=33.20  Aligned_cols=52  Identities=10%  Similarity=0.091  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             1788899889999999999999999999---999983799999999999999999
Q gi|254780494|r    4 YKARSKSEESLLKLSICMTIFMASVNLI---IGTITNSSSIVFDGFYSYLEAGMT   55 (314)
Q Consensus         4 ~~~~~~~e~~~L~~sl~~~~~~a~~~~~---~g~~sgS~allada~~sl~D~~~~   55 (314)
                      ..+.+|+--.++.+.....++..+.++.   .+.++.|.=++.|++--++..++.
T Consensus        17 ~~~~~r~l~~~~~L~~~f~~iE~i~g~~s~SlaLLADa~Hml~D~~al~lal~A~   71 (296)
T COG1230          17 NPRNERRLLIALLLNLAFMLIEIIGGLLTGSLALLADALHMLSDALALLLALIAI   71 (296)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             3057889999999999999999999999656999973777889999999999999


No 19 
>TIGR01297 CDF cation diffusion facilitator family transporter; InterPro: IPR002524   Members of this family are integral membrane proteins, that are found to increase tolerance to divalent metal ions such as cadmium, zinc, and cobalt. These proteins are considered to be efflux pumps that remove these ions from cells , , however others are implicated in ion uptake . The family has six predicted transmembrane domains. Members of the family are variable in length because of variably sized inserts, often containing low-complexity sequence.; GO: 0008324 cation transmembrane transporter activity, 0006812 cation transport, 0016020 membrane.
Probab=95.83  E-value=0.13  Score=28.67  Aligned_cols=90  Identities=20%  Similarity=0.203  Sum_probs=52.1

Q ss_pred             HHHHHHHHHHHHHHHH--HHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCC-CCHHHHHHH
Q ss_conf             9999999999999999--99983--799999999999999999999999999820000120378964375-204568999
Q gi|254780494|r   17 LSICMTIFMASVNLII--GTITN--SSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQ-FGFWHFEPM   91 (314)
Q Consensus        17 ~sl~~~~~~a~~~~~~--g~~sg--S~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p-~G~~r~E~l   91 (314)
                      .++..|...+....-.  |.-.+  |.++.++..|...|...+...+.+.....              +. ||+.-.+++
T Consensus       116 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~--------------~~~~~~~~~d~~  181 (294)
T TIGR01297       116 LGLLVNLILALLLLRGHGGHKLGHGSLNLRAAALHVLGDLLGSLGVLIGALLIY--------------FGPFGWTWADPI  181 (294)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------------HHCCCCHHHHHH
T ss_conf             999999999999986420221100147899999998888899999999999987--------------402550377789


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999999999999999999998514798
Q gi|254780494|r   92 VLAFNSVILICVALYEFLISILNIISGGH  120 (314)
Q Consensus        92 ~~l~~~~~l~~~~~~i~~~si~~l~~~~~  120 (314)
                      .++..+++++..+..++.+++..++...+
T Consensus       182 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  210 (294)
T TIGR01297       182 AALLISLLILYTAFRLLKESINVLLDGAP  210 (294)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999999999899999999999851035


No 20 
>KOG1484 consensus
Probab=94.66  E-value=0.3  Score=26.41  Aligned_cols=93  Identities=13%  Similarity=0.036  Sum_probs=72.0

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99986688998764103577799999998757887421357999999998301344420467998999999999999889
Q gi|254780494|r  134 ASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAI  213 (314)
Q Consensus       134 ~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~  213 (314)
                      .++.|..+.+..--++-..+|-.+..|+.|-.-|+.+....+.+-.++.......+.++...+..++++.-+++....++
T Consensus        40 f~llnl~~~fv~l~y~~~snSlgLiSda~hm~FDctal~~gL~a~~is~~~~~~~fsyG~~r~evLagF~n~vflvl~a~  119 (354)
T KOG1484          40 FLLLNLAFMFVELFYGSWSNSLGLISDAFHMFFDCTALLAGLYASVISKWPANDKFSYGYGRIEVLAGFVNGVFLVLIAF  119 (354)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99998999999999864367178788899999999999852457787417885556742677889999999899999999


Q ss_pred             HHHHHHHHHHHHC
Q ss_conf             9999999999530
Q gi|254780494|r  214 CTMKSATFEIFQM  226 (314)
Q Consensus       214 ~~~~~~~~~Ll~~  226 (314)
                      .+..|++..|++-
T Consensus       120 fi~~Es~eRl~~p  132 (354)
T KOG1484         120 FIFSESVERLFDP  132 (354)
T ss_pred             HHHHHHHHHHCCC
T ss_conf             9769999985091


No 21 
>COG4956 Integral membrane protein (PIN domain superfamily) [General function prediction only]
Probab=93.51  E-value=0.52  Score=24.99  Aligned_cols=100  Identities=14%  Similarity=0.293  Sum_probs=64.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99999999986688998764103577799999998757887421357999999998301344420467998999999999
Q gi|254780494|r  128 VIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDSAYDWIIPYVDSMVLMFICLF  207 (314)
Q Consensus       128 ~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~s~~v~i~~~~~~~~~~~~~~~~~~~~D~i~alii~l~  207 (314)
                      ++.+++..++..+...+.-+..|+..+...+.....   =.+.+.|.++|++++.+....-.....|++-++.+.++.++
T Consensus        45 ligai~~~li~~~~~~~~~~~~~~le~~i~k~~~~~---ilf~tiGLiiGLlia~l~~~pL~~~~ip~~~~ii~vi~t~i  121 (356)
T COG4956          45 LIGAIIFFLISFWFGKYVLNWLKRLEEQIRKLPVTT---ILFGTIGLIIGLLIAVLLSSPLFLLPIPFISTIIPVILTII  121 (356)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
T ss_conf             999999999999999999999999999998368999---99987889999999999853776279607776899999999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHH
Q ss_conf             99988999999999995309978
Q gi|254780494|r  208 ILPSAICTMKSATFEIFQMTSPD  230 (314)
Q Consensus       208 ii~~~~~~~~~~~~~Ll~~~~~~  230 (314)
                      +.+.++.+.-....+++.-.++.
T Consensus       122 l~y~G~~~~~k~~de~~~l~~~~  144 (356)
T COG4956         122 LAYFGFQLADKKRDEFLRLLNPN  144 (356)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCHH
T ss_conf             99973677640148898750544


No 22 
>PRK08676 hydrogenase membrane subunit; Validated
Probab=93.36  E-value=0.55  Score=24.83  Aligned_cols=28  Identities=14%  Similarity=0.103  Sum_probs=11.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7999999999999999999999999998
Q gi|254780494|r   38 SSSIVFDGFYSYLEAGMTALSLLVAKLI   65 (314)
Q Consensus        38 S~allada~~sl~D~~~~~~~l~~~~~~   65 (314)
                      +.=+.-|++-.+.-.+...+...+.-++
T Consensus        55 ~~~~~iD~Ls~~~l~l~~~v~~l~~lyS   82 (486)
T PRK08676         55 SRYLFIDHLGLFVVLIASLIFILAALYA   82 (486)
T ss_pred             CCHHEECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             7222166616999999999999999998


No 23 
>pfam06570 DUF1129 Protein of unknown function (DUF1129). This family consists of several hypothetical bacterial proteins of unknown function.
Probab=82.13  E-value=3.4  Score=19.96  Aligned_cols=162  Identities=13%  Similarity=0.119  Sum_probs=68.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999837999999999999999999999999998200001203789643752045689999999999999
Q gi|254780494|r   22 TIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFWHFEPMVLAFNSVILI  101 (314)
Q Consensus        22 ~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~r~E~l~~l~~~~~l~  101 (314)
                      .+--++-++..+.-.|=.|=-.-|  +        .+-++..+.+..     .+++....+        ...+..--.++
T Consensus        30 ~l~e~~~~lle~Qk~G~TArqLyG--t--------Pte~a~~i~~~~-----~~~~~~~~~--------~w~~alD~~Ll   86 (206)
T pfam06570        30 ILEEMLPEILEGQKKGITARQLYG--T--------PTEKAAEILNPP-----KKPAKRPKN--------PWLMALDNSLL   86 (206)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHCC--C--------HHHHHHHHHCCC-----CCCCCCCCC--------HHHHHHHHHHH
T ss_conf             999999999988745941999769--8--------799999862788-----786667874--------58999998289


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHC--CCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999998514798765117999999999986688998764103--57779999999875788742135799999
Q gi|254780494|r  102 CVALYEFLISILNIISGGHDINFEKAVIYSCVASFICLMMGVYENRCNR--EIKSDFIALDAKSWIVAGYLLLAVVIAFL  179 (314)
Q Consensus       102 ~~~~~i~~~si~~l~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~~~~~--~~~s~~l~~~~~~~~~D~~~s~~v~i~~~  179 (314)
                      +.+++.+..++..+++++........+.+.+.+++....++.+.+...+  +.++.  +   ..+..-.+...++++...
T Consensus        87 ~~~if~~m~Gi~~~Fs~~~~~~~~Gi~tlil~~~~gG~~m~~~~~~l~~~~~~k~k--r---~~~~k~i~~~~~~~v~w~  161 (206)
T pfam06570        87 FLGIFALMNGIMALFSKNAQPAYSGITTLLLTSLVGGLAMYYMYRYLYRYLKDKSK--R---PPWWKSLLILVLAVVVWM  161 (206)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC--C---CHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999478888775529999999999999999999996413356532--4---229999999999999999


Q ss_pred             HHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99983013444204679989999999999998
Q gi|254780494|r  180 CAMLLRDSAYDWIIPYVDSMVLMFICLFILPS  211 (314)
Q Consensus       180 ~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~  211 (314)
                      +.+....--...+.|-+.|.+-++++..-+..
T Consensus       162 ~~~~~~~~lP~~INP~Lp~~v~iiigaia~~~  193 (206)
T pfam06570       162 AVFTLTSMLPPVINPVLPPWVYIIIGAIAFGV  193 (206)
T ss_pred             HHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99999997612258898669999999999999


No 24 
>PRK02047 hypothetical protein; Provisional
Probab=80.13  E-value=4  Score=19.53  Aligned_cols=60  Identities=10%  Similarity=0.074  Sum_probs=38.4

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             530997899999999971576115100016787046769999999988899861099999999999
Q gi|254780494|r  224 FQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEI  289 (314)
Q Consensus       224 l~~~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i  289 (314)
                      +|.+.+++.+.|.+++..+....+-.+...|..+.|+..-+.+.+.+.      +-+++|++=+++
T Consensus        22 mG~a~~~~~~~V~~iv~~h~p~~~~~~v~~r~S~~G~Y~Svtv~i~at------s~~QLd~iY~~L   81 (91)
T PRK02047         22 MGKAHPEFADTIFKVVSVHDPEFDLEKIEERPSSGGNYTGLTITVRAT------SREQLDNIYRAL   81 (91)
T ss_pred             EECCCCCHHHHHHHHHHHHCCCCCCCCEEECCCCCCEEEEEEEEEEEC------CHHHHHHHHHHH
T ss_conf             975871078999999999779998033787149998689999999989------999999999998


No 25 
>PRK06458 hydrogenase 4 subunit F; Validated
Probab=77.00  E-value=4.9  Score=18.95  Aligned_cols=13  Identities=15%  Similarity=0.158  Sum_probs=4.8

Q ss_pred             HHHHHHHHHHHHHH
Q ss_conf             99999999999988
Q gi|254780494|r  199 MVLMFICLFILPSA  212 (314)
Q Consensus       199 i~alii~l~ii~~~  212 (314)
                      +.+++ +..+.+.+
T Consensus       248 vSall-s~v~~k~g  260 (491)
T PRK06458        248 VSAVL-SGVLLNVA  260 (491)
T ss_pred             HHHHH-HHHHHHHH
T ss_conf             89999-99999999


No 26 
>pfam04359 DUF493 Protein of unknown function (DUF493).
Probab=73.06  E-value=6.2  Score=18.33  Aligned_cols=63  Identities=10%  Similarity=0.082  Sum_probs=39.4

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5309978999999999715761151000167870467699999999888998610999999999999998654
Q gi|254780494|r  224 FQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGL  296 (314)
Q Consensus       224 l~~~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~  296 (314)
                      +|.+.+++.+.|.+++..+....+......+..+.|+..-+.+.+.+.      +-++.+.    |-++|++.
T Consensus        21 iG~~~~~f~~~V~~iv~~h~~~~~~~~v~~r~Ss~GkY~Svtv~i~a~------s~~ql~~----iy~~L~~~   83 (90)
T pfam04359        21 MGLAGDELVDAVVEVVQRHAPGFDDYTPTVKPSSKGKYVSVSVTITAT------SEEQLEA----LYQELSAI   83 (90)
T ss_pred             EECCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCEEEEEEEEEEC------CHHHHHH----HHHHHHCC
T ss_conf             970871689999999999779998332378646898489999999988------9999999----99998319


No 27 
>COG4858 Uncharacterized membrane-bound protein conserved in bacteria [Function unknown]
Probab=73.05  E-value=6.2  Score=18.33  Aligned_cols=114  Identities=15%  Similarity=0.146  Sum_probs=51.8

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCC-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999985147987651-17999999999986688998764103577799999998757887421357999
Q gi|254780494|r   99 ILICVALYEFLISILNIISGGHDINF-EKAVIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIA  177 (314)
Q Consensus        99 ~l~~~~~~i~~~si~~l~~~~~~~~~-~~~~i~~~~~~~~~~~l~~~~~~~~~~~~s~~l~~~~~~~~~D~~~s~~v~i~  177 (314)
                      .+++.|++.+..++..+++.....-. ...++.++++.+....++.|.++..- .+|  .+.-  .|+.-...++.+.+=
T Consensus       101 sLl~lg~~aLlsgitaff~~nA~~~GlItlll~a~vgGfamy~my~y~yr~~a-d~s--qr~~--~~K~~lv~~~sm~lW  175 (226)
T COG4858         101 SLLFLGAMALLSGITAFFQKNAQVYGLITLLLTAVVGGFAMYIMYYYAYRMRA-DNS--QRPG--TWKYLLVAVLSMLLW  175 (226)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCC--CCCC--HHHHHHHHHHHHHHH
T ss_conf             29999999999999999962883021799999998666999999999987624-345--5884--199999999999999


Q ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999830134442046799899999999999988999999
Q gi|254780494|r  178 FLCAMLLRDSAYDWIIPYVDSMVLMFICLFILPSAICTMKS  218 (314)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~D~i~alii~l~ii~~~~~~~~~  218 (314)
                      +.+- +....-.....|-+||+.-.+++..++..-+-+-|.
T Consensus       176 i~v~-i~t~~lPtslN~~L~pi~l~IiGav~lalRfylkkk  215 (226)
T COG4858         176 IAVM-IATVFLPTSLNPQLPPIALTIIGAVILALRFYLKKK  215 (226)
T ss_pred             HHHH-HHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999-999507876786786199999999999999999986


No 28 
>PRK10334 mechanosensitive channel MscS; Provisional
Probab=72.85  E-value=6.3  Score=18.30  Aligned_cols=76  Identities=7%  Similarity=-0.018  Sum_probs=46.8

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEEEEECC-EEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH---CCCEEEEEEEEC
Q ss_conf             9999999715761151000167870467-699999999888998610999999999999998654---892199999854
Q gi|254780494|r  233 SQVREALYPIVIRHGFLDFYTYVTKVGR-SRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGL---GEERWLTISFTT  308 (314)
Q Consensus       233 ~~I~~~i~~~~~v~~v~~~~i~~~~~G~-~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~---~~~~~~~i~F~~  308 (314)
                      +-+.+++.+.+.+..-....++....|. .+...+..-+++. +..  ....++.+++++++++.   .|-++.++|+..
T Consensus       203 ~il~~~~~~~~~vl~~p~p~v~v~~~~dssi~~~v~~wv~~~-~~~--~~~~dl~~~Ik~~f~~~GI~IPfPq~~vh~~~  279 (285)
T PRK10334        203 QILTNIIQSEDRILKDREMTVRLNELGASSINFVVRVWSNSG-DLQ--NVYWDVLERIKREFDAAGISFPYPQMDVNFKR  279 (285)
T ss_pred             HHHHHHHHHCCHHHCCCCCEEEEEEECCCEEEEEEEEEECCC-CHH--HHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEE
T ss_conf             999999870800114899889982785855899999998853-089--99999999999999987996899988999610


Q ss_pred             CCC
Q ss_conf             765
Q gi|254780494|r  309 QKK  311 (314)
Q Consensus       309 ~~~  311 (314)
                      .+|
T Consensus       280 ~~~  282 (285)
T PRK10334        280 VKE  282 (285)
T ss_pred             CCC
T ss_conf             687


No 29 
>COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only]
Probab=66.34  E-value=8.7  Score=17.44  Aligned_cols=33  Identities=12%  Similarity=0.267  Sum_probs=28.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCC
Q ss_conf             999999999999865489219999985476555
Q gi|254780494|r  281 SLDAIRHEIGNAIGGLGEERWLTISFTTQKKWA  313 (314)
Q Consensus       281 e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~~~~  313 (314)
                      -.+.+.+++++++++..+.-...++++.+|.|.
T Consensus        64 ~~~~i~~~v~~al~~~~~v~~v~V~l~~~p~Wt   96 (111)
T COG2151          64 LAEVIADQVEAALEEIPGVEDVEVELTLSPPWT   96 (111)
T ss_pred             CHHHHHHHHHHHHHHCCCCCEEEEEEEEECCCC
T ss_conf             207889999999984688130799999707966


No 30 
>PRK12665 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=64.09  E-value=9.6  Score=17.18  Aligned_cols=32  Identities=6%  Similarity=0.107  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98899999999999999999999999837999
Q gi|254780494|r   10 SEESLLKLSICMTIFMASVNLIIGTITNSSSI   41 (314)
Q Consensus        10 ~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~al   41 (314)
                      ...+-+..+.+....+.+.-...+..+|++.+
T Consensus       162 Aa~ky~i~~~~gs~~~L~gi~~ly~~tGtln~  193 (524)
T PRK12665        162 AGVTYVMVSMVSSLLFLIGIAMVYAATGTLNM  193 (524)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             99999999999999999999999998088779


No 31 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; InterPro: IPR011883 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , . Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA .    .
Probab=51.27  E-value=16  Score=15.84  Aligned_cols=33  Identities=24%  Similarity=0.491  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCC
Q ss_conf             999999999999865489219999985476555
Q gi|254780494|r  281 SLDAIRHEIGNAIGGLGEERWLTISFTTQKKWA  313 (314)
Q Consensus       281 e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~~~~  313 (314)
                      ..|.+++.|+++++..+..-.+.|.|+.||-|.
T Consensus        41 A~~~i~~~i~~A~~~~GW~~~VeV~~~L~P~WT   73 (152)
T TIGR02159        41 ALEVIRQDIRDALRALGWVEEVEVKTSLDPAWT   73 (152)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCC
T ss_conf             689999999999974789751158877189878


No 32 
>pfam06772 LtrA Bacterial low temperature requirement A protein (LtrA). This family consists of several bacteria specific low temperature requirement A (LtrA) protein sequences which have been found to be essential for growth at low temperatures in Listeria monocytogenes.
Probab=50.23  E-value=16  Score=15.74  Aligned_cols=26  Identities=4%  Similarity=-0.079  Sum_probs=15.9

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             51179999999999866889987641
Q gi|254780494|r  123 NFEKAVIYSCVASFICLMMGVYENRC  148 (314)
Q Consensus       123 ~~~~~~i~~~~~~~~~~~l~~~~~~~  148 (314)
                      .....+..+..+.+....++|.....
T Consensus       211 ~~~~~i~~~~~~f~~~~~lWW~YF~~  236 (354)
T pfam06772       211 LTLTTILAAALSFLIAVALWWIYFHQ  236 (354)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             75688999999999999999999814


No 33 
>COG4146 Predicted symporter [General function prediction only]
Probab=49.83  E-value=17  Score=15.70  Aligned_cols=36  Identities=11%  Similarity=0.137  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999983799999999999999
Q gi|254780494|r   15 LKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEA   52 (314)
Q Consensus        15 L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~   52 (314)
                      +.+|...-+.....-+-...+||  |+..|.++++.++
T Consensus       119 ~Iis~lFLi~y~~~flPtvLYsG--Ala~nsiF~l~~v  154 (571)
T COG4146         119 MIISFLFLIAYGVCFLPTVLYSG--ALALNSIFHLGEV  154 (571)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHC--HHHHHHHHCHHHH
T ss_conf             99999999998887513887623--4887653034766


No 34 
>PRK11646 multidrug resistance protein MdtH; Provisional
Probab=47.54  E-value=18  Score=15.48  Aligned_cols=40  Identities=8%  Similarity=0.109  Sum_probs=28.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCHHHHHH
Q ss_conf             7998999999999999889999999999953-099789999
Q gi|254780494|r  195 YVDSMVLMFICLFILPSAICTMKSATFEIFQ-MTSPDLDSQ  234 (314)
Q Consensus       195 ~~D~i~alii~l~ii~~~~~~~~~~~~~Ll~-~~~~~~~~~  234 (314)
                      +.+....++++..++..+--+...+.+.+.. .+|++..-+
T Consensus       293 ~~~~~~~~~i~~~lftiGe~l~~P~~~s~va~lap~~~rG~  333 (400)
T PRK11646        293 MVSNLQQLFTLICLFYIGSIIAEPARETLSASLADARARGS  333 (400)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEH
T ss_conf             99889999999999999999997548999998389654323


No 35 
>PRK00341 hypothetical protein; Provisional
Probab=46.15  E-value=19  Score=15.35  Aligned_cols=60  Identities=15%  Similarity=0.084  Sum_probs=35.2

Q ss_pred             HHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHH
Q ss_conf             5309978999999999715761151000167870467699999999888998610999999999999
Q gi|254780494|r  224 FQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIG  290 (314)
Q Consensus       224 l~~~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~  290 (314)
                      +|.+.+++.+.|.+++..+.. .+-.....|..+.|+  ++++.+.+..    .+-+++|++=+++.
T Consensus        23 mG~~~~~f~~~V~~iv~~ha~-~d~~~i~~r~Ss~G~--y~SvTv~i~A----ts~~QLd~ly~~L~   82 (91)
T PRK00341         23 IGDTGVGFKDLVIEILQKHAD-VDLETLAERQSSNGK--YTTVQLHIVA----TSEDQLQDINSALR   82 (91)
T ss_pred             EECCCCHHHHHHHHHHHHCCC-CCCCCEEEECCCCCE--EEEEEEEEEE----CCHHHHHHHHHHHH
T ss_conf             875872088999999987289-881143781389973--8999999998----99999999999973


No 36 
>pfam02426 MIase Muconolactone delta-isomerase. This small enzyme forms a homodecameric complex, that catalyses the third step in the catabolism of catechol to succinate- and acetyl-coa in the beta-ketoadipate pathway EC:5.3.3.4. The protein has a ferredoxin-like fold according to SCOP.
Probab=45.37  E-value=20  Score=15.28  Aligned_cols=24  Identities=17%  Similarity=0.231  Sum_probs=14.0

Q ss_pred             HHHHHHHHHCCCEEEEEEEECCCC
Q ss_conf             999998654892199999854765
Q gi|254780494|r  288 EIGNAIGGLGEERWLTISFTTQKK  311 (314)
Q Consensus       288 ~i~~~l~~~~~~~~~~i~F~~~~~  311 (314)
                      ++++-|...+-..|.+|+-|+=-+
T Consensus        63 eLh~iL~sLPL~p~m~ieVtpL~~   86 (91)
T pfam02426        63 ELHDLLSSLPLFPYMDIEVTPLCR   86 (91)
T ss_pred             HHHHHHHCCCCCCCEEEEEEECCC
T ss_conf             999999709997523315775567


No 37 
>PRK10054 putative MFS-type transporter YdeE; Provisional
Probab=45.13  E-value=20  Score=15.25  Aligned_cols=39  Identities=3%  Similarity=0.221  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCHHHHHHH
Q ss_conf             98999999999999889999999999953-0997899999
Q gi|254780494|r  197 DSMVLMFICLFILPSAICTMKSATFEIFQ-MTSPDLDSQV  235 (314)
Q Consensus       197 D~i~alii~l~ii~~~~~~~~~~~~~Ll~-~~~~~~~~~I  235 (314)
                      |.+..+.++..+...+=-+.-.+...+.+ .+|++..-+.
T Consensus       296 ~~~~~~~i~~~ifTiGE~i~~P~~~~~v~~laP~~~RG~Y  335 (395)
T PRK10054        296 NNLLFWGMSAAVFTVGEIIYAPGEYMLIDNIAPPGMKASY  335 (395)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHH
T ss_conf             7899999999999999999865599999873993403258


No 38 
>PRK12664 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=44.45  E-value=20  Score=15.19  Aligned_cols=87  Identities=11%  Similarity=-0.002  Sum_probs=48.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCCCCHH
Q ss_conf             88998899999999999999999999999837999999999999999999999999998200001203789643752045
Q gi|254780494|r    7 RSKSEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYFQFGFW   86 (314)
Q Consensus         7 ~~~~e~~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~p~G~~   86 (314)
                      .|+.-||.|--+.+.++.+++..+..+...+-.+.-+-..|.+.+..-..+.+.+.-....     .-...|-+.=-|..
T Consensus       222 ~Q~DiKRlLAYSsVsQiGymv~giG~~~ig~~~a~~~ai~H~~~H~l~KalLFm~aGaV~~-----~TGt~~i~~LGGL~  296 (530)
T PRK12664        222 LEQNIRRLLCYNVVGQMGLLITAIGFSYSSSVSVIGIIILQIVLSVVYQTLLFMVADSVIN-----RTRKFNLNEVGGLF  296 (530)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHCCCCHHHHCCHH
T ss_conf             9874999999999989999999986511221768999999999999999999999879999-----80871178855898


Q ss_pred             HHHHHHHHHHHH
Q ss_conf             689999999999
Q gi|254780494|r   87 HFEPMVLAFNSV   98 (314)
Q Consensus        87 r~E~l~~l~~~~   98 (314)
                      |..|+.....-+
T Consensus       297 k~MP~Ta~~~lI  308 (530)
T PRK12664        297 KKMSVEAICSII  308 (530)
T ss_pred             HHHHHHHHHHHH
T ss_conf             761199999999


No 39 
>TIGR00906 2A0303 cationic amino acid transport permease; InterPro: IPR004755 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related , , . These proteins seem to contain up to 12 transmembrane segments. The best conserved region in this family is located in the second transmembrane segment.   Some proteins in this family are low-affinity, high capacity permeases involved in the transport of arginine, lysine and ornithine, the cationinc amino acids.; GO: 0006865 amino acid transport, 0016021 integral to membrane.
Probab=43.33  E-value=21  Score=15.08  Aligned_cols=96  Identities=9%  Similarity=0.063  Sum_probs=44.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCC--CCCHHHHHH
Q ss_conf             999999999999999999999998379999999999999999999999999982000012037896437--520456899
Q gi|254780494|r   13 SLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRERERYF--QFGFWHFEP   90 (314)
Q Consensus        13 ~~L~~sl~~~~~~a~~~~~~g~~sgS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~~~~~--p~G~~r~E~   90 (314)
                      ++-++....|++..+.=+++|+.-++...-.-+- ...|                ..+...|+||+++-  -||.+++-|
T Consensus       192 ~vN~~f~~in~~VL~FViiaGf~kadv~nw~~te-~~~~----------------~~~~sarePP~~~~~~~YG~g~F~P  254 (616)
T TIGR00906       192 RVNKIFTIINLLVLLFVIIAGFVKADVKNWSITE-EFLK----------------NISASAREPPSENGTSIYGAGGFMP  254 (616)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCHHCCHHHHHHHH-HHHH----------------CCCCCCCCCCCCCCCEEECCCCCCC
T ss_conf             5889999999999999998422310110213205-5510----------------0002247898878714305787214


Q ss_pred             HH-----HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             99-----999999999999999999999851479876511
Q gi|254780494|r   91 MV-----LAFNSVILICVALYEFLISILNIISGGHDINFE  125 (314)
Q Consensus        91 l~-----~l~~~~~l~~~~~~i~~~si~~l~~~~~~~~~~  125 (314)
                      -+     .-..-+|..++|+-.+...-++--||++..+-+
T Consensus       255 YG~~G~l~gAAtcFfAFiGFda~aT~gEE~kNP~r~IPig  294 (616)
T TIGR00906       255 YGFRGVLSGAATCFFAFIGFDAIATTGEEVKNPQRAIPIG  294 (616)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCCHH
T ss_conf             5224243377889888773677610101004779755088


No 40 
>pfam09877 DUF2104 Predicted membrane protein (DUF2104). This domain, found in various hypothetical archaeal proteins, has no known function.
Probab=43.06  E-value=21  Score=15.06  Aligned_cols=17  Identities=24%  Similarity=0.391  Sum_probs=6.6

Q ss_pred             CHHHHHHHHHHHHHHHH
Q ss_conf             04568999999999999
Q gi|254780494|r   84 GFWHFEPMVLAFNSVIL  100 (314)
Q Consensus        84 G~~r~E~l~~l~~~~~l  100 (314)
                      ||||.|...+++.+++.
T Consensus        79 GYGr~E~~~G~iiA~i~   95 (100)
T pfam09877        79 GYGRIETVLGLIIALIL   95 (100)
T ss_pred             CCCHHHHHHHHHHHHHH
T ss_conf             98736899999999999


No 41 
>PRK06277 hydrogenase subunit F; Validated
Probab=42.24  E-value=22  Score=14.98  Aligned_cols=16  Identities=0%  Similarity=0.038  Sum_probs=5.2

Q ss_pred             HHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999
Q gi|254780494|r   43 FDGFYSYLEAGMTALS   58 (314)
Q Consensus        43 ada~~sl~D~~~~~~~   58 (314)
                      .|....+.-.....+.
T Consensus        70 ~d~l~~~~~~~~~l~~   85 (479)
T PRK06277         70 YGPAKQLIITVLMLIA   85 (479)
T ss_pred             ECHHHHHHHHHHHHHH
T ss_conf             5306699999999999


No 42 
>PRK10597 DNA damage-inducible protein I; Provisional
Probab=42.06  E-value=22  Score=14.96  Aligned_cols=41  Identities=17%  Similarity=0.322  Sum_probs=21.6

Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCE--EEEEEEE
Q ss_conf             9999998889986109999999999999986548921--9999985
Q gi|254780494|r  264 IEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEER--WLTISFT  307 (314)
Q Consensus       264 vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~--~~~i~F~  307 (314)
                      +|+.+.=...+|.-   ..+.+..|+.+++++.||+.  ++.|.+.
T Consensus         3 vEi~idK~~~lP~g---a~~AL~~EL~kRl~~~fPD~~~~V~Vr~~   45 (81)
T PRK10597          3 IEVTIAKTSPLPAG---AIDALAGELSRRIQYAFPDNEGHVSVRYA   45 (81)
T ss_pred             EEEEEECCCCCCCC---HHHHHHHHHHHHHHHHCCCCCCEEEEEEC
T ss_conf             79987416769976---59999999999866348986550688545


No 43 
>COG4394 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.06  E-value=22  Score=14.96  Aligned_cols=19  Identities=21%  Similarity=0.183  Sum_probs=7.7

Q ss_pred             HHHHHHHHHHHHHHHCCCH
Q ss_conf             8899999999999530997
Q gi|254780494|r  211 SAICTMKSATFEIFQMTSP  229 (314)
Q Consensus       211 ~~~~~~~~~~~~Ll~~~~~  229 (314)
                      +++...|.+.+-++-..|.
T Consensus       193 s~ieq~r~a~~p~llL~~e  211 (370)
T COG4394         193 SWIEQLRKADKPILLLIPE  211 (370)
T ss_pred             HHHHHHHHCCCCEEEECCC
T ss_conf             9999999659977998245


No 44 
>TIGR03221 muco_delta muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol.
Probab=42.01  E-value=22  Score=14.96  Aligned_cols=45  Identities=18%  Similarity=0.198  Sum_probs=23.7

Q ss_pred             EEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCC
Q ss_conf             167870467699999999888998610999999999999998654892199999854765
Q gi|254780494|r  252 YTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQKK  311 (314)
Q Consensus       252 ~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~~  311 (314)
                      |+|- -.|+...+.+- .++      +.+       ++++-|...+-..|.+|+-|+=-+
T Consensus        41 ~lWR-v~G~yan~sIf-dv~------s~~-------eLh~iL~sLPLfpym~i~VtpL~~   85 (90)
T TIGR03221        41 HLWR-VAGEYANYSIF-DVE------SND-------ELHTLLSGLPLFPYMDIEVTPLAR   85 (90)
T ss_pred             EEEE-ECCCCEEEEEE-ECC------CHH-------HHHHHHHCCCCCCCEEEEEEECCC
T ss_conf             8887-25741157899-749------879-------999999709997525305666124


No 45 
>PRK05846 NADH dehydrogenase subunit M; Reviewed
Probab=41.85  E-value=22  Score=14.94  Aligned_cols=22  Identities=23%  Similarity=0.140  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999
Q gi|254780494|r   43 FDGFYSYLEAGMTALSLLVAKL   64 (314)
Q Consensus        43 ada~~sl~D~~~~~~~l~~~~~   64 (314)
                      .|++-...-.....+.+.+..+
T Consensus        80 ~D~ls~~~~~l~~~v~~~~~l~  101 (495)
T PRK05846         80 VDGISLLLVVLTALLTPLAVLA  101 (495)
T ss_pred             ECHHHHHHHHHHHHHHHHHHHH
T ss_conf             1087899999999999999999


No 46 
>PRK08238 hypothetical protein; Validated
Probab=40.31  E-value=23  Score=14.79  Aligned_cols=36  Identities=14%  Similarity=-0.023  Sum_probs=23.0

Q ss_pred             HCCCCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             2037896437-52045689999999999999999999
Q gi|254780494|r   72 VDYRERERYF-QFGFWHFEPMVLAFNSVILICVALYE  107 (314)
Q Consensus        72 ~~~k~~~~~~-p~G~~r~E~l~~l~~~~~l~~~~~~i  107 (314)
                      +++++|.+++ |+--|++-...+...+.+++..++.+
T Consensus       255 ~DR~Hp~Kr~RP~ASG~ls~~~~~~~~~~ll~~~~~~  291 (481)
T PRK08238        255 ADRAHPRKRRRPFASGALPIPFGLAAAPVLLLAALAL  291 (481)
T ss_pred             HHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             5416862456977778889889999999999999999


No 47 
>PRK04201 zinc transporter ZupT; Provisional
Probab=38.49  E-value=25  Score=14.62  Aligned_cols=26  Identities=8%  Similarity=-0.110  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999985
Q gi|254780494|r   90 PMVLAFNSVILICVALYEFLISILNI  115 (314)
Q Consensus        90 ~l~~l~~~~~l~~~~~~i~~~si~~l  115 (314)
                      .+.++..|+++....+.++-++++..
T Consensus        38 ~~lgfAaGVMLaasf~~Llpea~e~~   63 (263)
T PRK04201         38 FSLGFAAGVMLYVSFVEILPKALEAL   63 (263)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999869999988


No 48 
>PRK06525 hydrogenase 4 subunit D; Validated
Probab=38.48  E-value=25  Score=14.62  Aligned_cols=25  Identities=4%  Similarity=0.009  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7998999999999999889999999
Q gi|254780494|r  195 YVDSMVLMFICLFILPSAICTMKSA  219 (314)
Q Consensus       195 ~~D~i~alii~l~ii~~~~~~~~~~  219 (314)
                      -..|..+++.+..+.+.+.-.+.+-
T Consensus       237 ap~pvsa~L~~~~~~k~g~y~l~r~  261 (480)
T PRK06525        237 APTPVSAYLHAASMVKVGVYIFARA  261 (480)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8975888999999999999999999


No 49 
>KOG2877 consensus
Probab=36.54  E-value=27  Score=14.43  Aligned_cols=26  Identities=12%  Similarity=-0.252  Sum_probs=12.8

Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             437520456899999999999999999
Q gi|254780494|r   79 RYFQFGFWHFEPMVLAFNSVILICVAL  105 (314)
Q Consensus        79 ~~~p~G~~r~E~l~~l~~~~~l~~~~~  105 (314)
                      -++|...+ -|....++...+..++.+
T Consensus       174 L~l~~~~g-tEgq~~i~~~~l~Tai~G  199 (389)
T KOG2877         174 LRLGRFDG-TEGQVSIIIVHLLTAIVG  199 (389)
T ss_pred             EEEEEEEC-CCHHHHHHHHHHHHHHHC
T ss_conf             99988733-201468999999999826


No 50 
>PRK09928 choline transport protein BetT; Provisional
Probab=35.07  E-value=28  Score=14.28  Aligned_cols=14  Identities=14%  Similarity=0.112  Sum_probs=6.5

Q ss_pred             CCCCCHHHHHHHHH
Q ss_conf             35777999999987
Q gi|254780494|r  150 REIKSDFIALDAKS  163 (314)
Q Consensus       150 ~~~~s~~l~~~~~~  163 (314)
                      ...+|..+-.+...
T Consensus       425 TSaDSgs~Vl~~~t  438 (679)
T PRK09928        425 TSADSGALVLGNFT  438 (679)
T ss_pred             HCCCHHHHHHHHHH
T ss_conf             52314899999986


No 51 
>PRK06473 NAD(P)H-quinone oxidoreductase subunit D4; Validated
Probab=34.53  E-value=29  Score=14.23  Aligned_cols=22  Identities=23%  Similarity=0.190  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999
Q gi|254780494|r   41 IVFDGFYSYLEAGMTALSLLVA   62 (314)
Q Consensus        41 llada~~sl~D~~~~~~~l~~~   62 (314)
                      +-.|++-...=..+..+.+.+.
T Consensus        75 l~vDgls~~ll~lt~~l~~i~i   96 (500)
T PRK06473         75 LGVDGLSLPLLVLNSLLTLIAI   96 (500)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHH
T ss_conf             5358889999999999999999


No 52 
>pfam11654 DUF2665 Protein of unknown function (DUF2665). Some members in this family are annotated as Non classical export proteins, however no specific function is known.
Probab=34.03  E-value=24  Score=14.70  Aligned_cols=18  Identities=11%  Similarity=0.034  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q ss_conf             467998999999999999
Q gi|254780494|r  193 IPYVDSMVLMFICLFILP  210 (314)
Q Consensus       193 ~~~~D~i~alii~l~ii~  210 (314)
                      ..++||+.++.++.+--+
T Consensus         4 sr~~DP~~ai~iG~~sYy   21 (47)
T pfam11654         4 SRTLDPILAISIGVASYY   21 (47)
T ss_pred             CHHHHHHHHHHHHHHHHH
T ss_conf             010014899999888998


No 53 
>PRK00907 hypothetical protein; Provisional
Probab=33.62  E-value=30  Score=14.14  Aligned_cols=61  Identities=10%  Similarity=0.079  Sum_probs=36.7

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             9530997899999999971576115100016787046769999999988899861099999999999
Q gi|254780494|r  223 IFQMTSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEI  289 (314)
Q Consensus       223 Ll~~~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i  289 (314)
                      -+|.+.+++..+|.+++.......+-.....|....|+  ++.+.+.+...    +-++.|.+=+.+
T Consensus        22 vMG~a~~~~~~~i~~iv~~~~~~~~~~~i~~r~SS~Gk--YisvTi~i~At----SReQlD~iYraL   82 (92)
T PRK00907         22 AMGTAERGLETELPRLLAATGVELVQERISWKHSSSGK--YVSVRIGFRAE----SREQYDAAHQAL   82 (92)
T ss_pred             HHCCCCCCHHHHHHHHHHHHCCCCCHHHEEECCCCCCE--EEEEEEEEEEC----CHHHHHHHHHHH
T ss_conf             74768600899999999995775485256764478982--79999999978----899999999987


No 54 
>TIGR03406 FeS_long_SufT probable FeS assembly SUF system protein SufT. The function is unknown for this protein family, but members are found almost always in operons for the the SUF system of iron-sulfur cluster biosynthesis. The SUF system is present elsewhere on the chromosome for those few species where SUF genes are not adjacent. This family shares this property of association with the SUF system with a related family, TIGR02945. TIGR02945 consists largely of a DUF59 domain (see pfam01883), while this protein is about double the length, with a unique N-terminal domain and DUF59 C-terminal domain. A location immediately downstream of the cysteine desulfurase gene sufS in many contexts suggests the gene symbol sufT. Note that some other homologs of this family and of TIGR02945, but no actual members of this family, are found in operons associated with phenylacetic acid (or other ring-hydroxylating) degradation pathways.
Probab=33.60  E-value=30  Score=14.14  Aligned_cols=76  Identities=14%  Similarity=0.137  Sum_probs=44.4

Q ss_pred             HHHHHHHHHHCCCCC-CCEEE------EEEEEEE---CCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEE
Q ss_conf             999999997157611-51000------1678704---6769999999988899861099999999999999865489219
Q gi|254780494|r  232 DSQVREALYPIVIRH-GFLDF------YTYVTKV---GRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERW  301 (314)
Q Consensus       232 ~~~I~~~i~~~~~v~-~v~~~------~i~~~~~---G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~  301 (314)
                      .++|-+.++.+..=+ .+...      ++.+...   |++..+.+++.-+.. |+     .+.+.+++++++....+.-.
T Consensus        75 E~~vweaLk~V~DPEIpVnIVdLGLIY~v~i~~~~~~~~~V~I~MTLTapgC-pm-----g~~i~~dv~~~v~~v~~v~~  148 (174)
T TIGR03406        75 EDQVWEQLRTVYDPEIPVNIVDLGLVYGCRVEKLGEGQFRVDIEMTLTAPGC-GM-----GPVLVEDVEDKVLAVPNVDE  148 (174)
T ss_pred             HHHHHHHHHHCCCCCCCCCEEEEEEEEEEEEEECCCCCCEEEEEEECCCCCC-CC-----CHHHHHHHHHHHHCCCCCCE
T ss_conf             9999999841559888754486302579998764788977999996047999-83-----17999999999977999664


Q ss_pred             EEEEEECCCCCC
Q ss_conf             999985476555
Q gi|254780494|r  302 LTISFTTQKKWA  313 (314)
Q Consensus       302 ~~i~F~~~~~~~  313 (314)
                      +.|+.+.||-|.
T Consensus       149 v~VelV~dPpW~  160 (174)
T TIGR03406       149 VEVELVFDPPWS  160 (174)
T ss_pred             EEEEEEECCCCC
T ss_conf             999999889989


No 55 
>pfam02038 ATP1G1_PLM_MAT8 ATP1G1/PLM/MAT8 family.
Probab=33.21  E-value=30  Score=14.10  Aligned_cols=33  Identities=15%  Similarity=0.195  Sum_probs=22.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9643752045689999999999999999999999
Q gi|254780494|r   77 RERYFQFGFWHFEPMVLAFNSVILICVALYEFLI  110 (314)
Q Consensus        77 ~~~~~p~G~~r~E~l~~l~~~~~l~~~~~~i~~~  110 (314)
                      .+..|.|-|+.+. +++|+.+.+++.+++.++..
T Consensus         4 ~~dpF~YDy~tLR-igGLi~a~vlfi~Gi~iils   36 (51)
T pfam02038         4 KEDPFYYDYETLR-IGGLIFAGVLFIVGIIIILS   36 (51)
T ss_pred             CCCCCCCCHHHHH-HCHHHHHHHHHHHHHHHHHC
T ss_conf             5788624458985-10059999999999999985


No 56 
>PTZ00302 N-acetylglucosamine-phosphate mutase; Provisional
Probab=32.46  E-value=31  Score=14.02  Aligned_cols=63  Identities=14%  Similarity=0.257  Sum_probs=43.3

Q ss_pred             CCHHHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9978999999999715761151000167870467699999999888998610999999999999998654
Q gi|254780494|r  227 TSPDLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGL  296 (314)
Q Consensus       227 ~~~~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~  296 (314)
                      .|+.++++|.+++.+.+... ...-+..+|-+|-.=.|=|+.+-+      |-+++|++..++.+..++.
T Consensus       538 ~P~gLQ~~Id~~V~~~~~~~-~~~GR~FVRPSGTEdvVRVYAEA~------T~e~ad~La~~Va~~V~~~  600 (604)
T PTZ00302        538 TPPGLQEAIDAAVAAAALSS-CEVARAFVRPSGTEPVVRVYAEAT------DPAVCESLSAEVEKIVERY  600 (604)
T ss_pred             CCHHHHHHHHHHHHHHHHHC-CCCEEEEECCCCCCCEEEEEEECC------CHHHHHHHHHHHHHHHHHH
T ss_conf             86878999999999998752-787339975478875789997039------8899999999999999986


No 57 
>pfam04219 DUF413 Protein of unknown function, DUF.
Probab=29.34  E-value=18  Score=15.42  Aligned_cols=13  Identities=23%  Similarity=0.327  Sum_probs=10.5

Q ss_pred             CCCCCCCCCHHHH
Q ss_conf             8964375204568
Q gi|254780494|r   76 ERERYFQFGFWHF   88 (314)
Q Consensus        76 ~~~~~~p~G~~r~   88 (314)
                      -+|++||+|+.|=
T Consensus         3 ~D~~nfPrGF~Rs   15 (94)
T pfam04219         3 YDDKNFPRGFSRS   15 (94)
T ss_pred             CCCCCCCCCCCCC
T ss_conf             7678788864527


No 58 
>PRK11027 hypothetical protein; Provisional
Probab=29.22  E-value=19  Score=15.41  Aligned_cols=15  Identities=20%  Similarity=0.146  Sum_probs=12.1

Q ss_pred             CCCCCCCCCCCHHHH
Q ss_conf             378964375204568
Q gi|254780494|r   74 YRERERYFQFGFWHF   88 (314)
Q Consensus        74 ~k~~~~~~p~G~~r~   88 (314)
                      +=-+|++||+|+.|=
T Consensus        10 rF~DdknfPrGF~Rs   24 (110)
T PRK11027         10 RFFDDKNFPRGFSRS   24 (110)
T ss_pred             CCCCCCCCCCCCCCC
T ss_conf             465567788764416


No 59 
>COG0779 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.56  E-value=36  Score=13.61  Aligned_cols=67  Identities=18%  Similarity=0.241  Sum_probs=48.1

Q ss_pred             HHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCE
Q ss_conf             9999999997157611510001678704676999999998889986109999999999999986548921
Q gi|254780494|r  231 LDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEER  300 (314)
Q Consensus       231 ~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~  300 (314)
                      ..+++.+.+..+-...++...++...+.|+...+.+.+.=+..+   ++++-.++.+.+...|....|..
T Consensus         6 ~~~~v~~li~p~~~~lG~ELv~ve~~~~~~~~~lrI~id~~g~v---~ldDC~~vSr~is~~LD~edpi~   72 (153)
T COG0779           6 ITEKVTELIEPVVESLGFELVDVEFVKEGRDSVLRIYIDKEGGV---TLDDCADVSRAISALLDVEDPIE   72 (153)
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCEEEEEECCCCCC---CHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             57899999987786449589999999728994899996799998---88999999999898736587666


No 60 
>TIGR01187 potA polyamine ABC transporter, ATP-binding protein; InterPro: IPR005893   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family comprises the spermidine/putrescine ABC transporter, ATP binding subunit in bacteria and its equivalents in archaea. This transport system belongs to the larger ATP-Binding Cassette (ABC) transporter superfamily. Polyamines like spermidine and putrescine play a vital role in cell proliferation, differentiation, and ion homeostasis. The concentration of polyamines within the cell are regulated by biosynthesis, degradation and transport (uptake and efflux included).; GO: 0015417 polyamine-transporting ATPase activity, 0015846 polyamine transport, 0016020 membrane.
Probab=28.39  E-value=37  Score=13.59  Aligned_cols=78  Identities=14%  Similarity=0.219  Sum_probs=48.3

Q ss_pred             HHCCCH-HHHHHHHHHHHHCCCCCCCEEEE--------------EEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHH
Q ss_conf             530997-89999999997157611510001--------------678704676999999998889986109999999999
Q gi|254780494|r  224 FQMTSP-DLDSQVREALYPIVIRHGFLDFY--------------TYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHE  288 (314)
Q Consensus       224 l~~~~~-~~~~~I~~~i~~~~~v~~v~~~~--------------i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~  288 (314)
                      ++..|. |+..+|++++.-+.=.. .-+-+              .|..-.+|++.     -+|+.+.+.+    -++|++
T Consensus        69 ~~k~~~~ei~~RV~e~L~~V~L~~-~a~rkp~qLSGGQ~QRvAlARa~v~kPk~L-----LlDEpLsALD----~kLR~~  138 (331)
T TIGR01187        69 MRKVPRAEIKPRVKEALRLVQLEE-FAKRKPHQLSGGQQQRVALARALVFKPKIL-----LLDEPLSALD----KKLRDQ  138 (331)
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCCH-HHCCCCCCCCCCHHHHHHHHHHHHCCCCEE-----EECCCHHHHH----HHHHHH
T ss_conf             178885668899999974213001-104673104685289999999986089567-----7117722643----898998


Q ss_pred             HHHHHHHHCCCEEEEEEE-ECCCC
Q ss_conf             999986548921999998-54765
Q gi|254780494|r  289 IGNAIGGLGEERWLTISF-TTQKK  311 (314)
Q Consensus       289 i~~~l~~~~~~~~~~i~F-~~~~~  311 (314)
                      .|.+|+....++-+|..| |||=+
T Consensus       139 MQ~ELk~~~~~LGiT~v~VTHDQ~  162 (331)
T TIGR01187       139 MQLELKTLQEQLGITFVFVTHDQE  162 (331)
T ss_pred             HHHHHHHHHHHCCCEEEEEECCHH
T ss_conf             899999998726828999701848


No 61 
>PRK10671 copA copper exporting ATPase; Provisional
Probab=27.38  E-value=38  Score=13.48  Aligned_cols=16  Identities=19%  Similarity=0.264  Sum_probs=7.1

Q ss_pred             EEEEEEECCEEEEEEE
Q ss_conf             1678704676999999
Q gi|254780494|r  252 YTYVTKVGRSRIIEIY  267 (314)
Q Consensus       252 ~i~~~~~G~~~~vev~  267 (314)
                      ++-+...|+--..+++
T Consensus       524 KTGTLT~G~~~v~~~~  539 (834)
T PRK10671        524 KTGTLTEGKPQVVAIK  539 (834)
T ss_pred             CCCCEECCCEEEEEEE
T ss_conf             7640125861699999


No 62 
>PRK07691 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=27.29  E-value=38  Score=13.47  Aligned_cols=26  Identities=19%  Similarity=0.098  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999999999982
Q gi|254780494|r   41 IVFDGFYSYLEAGMTALSLLVAKLIA   66 (314)
Q Consensus        41 llada~~sl~D~~~~~~~l~~~~~~~   66 (314)
                      +..|++..+.-....++.+...-++.
T Consensus        74 ~~~D~ls~~~~ll~~~v~~l~~lys~   99 (498)
T PRK07691         74 FVADIFAALLVLTSIIITAIVILYSF   99 (498)
T ss_pred             EEECHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             55407668999999999999999998


No 63 
>PRK08667 hydrogenase membrane subunit; Validated
Probab=26.38  E-value=40  Score=13.37  Aligned_cols=94  Identities=18%  Similarity=0.033  Sum_probs=64.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCC
Q ss_conf             8889988999999999999999999999998--------37999999999999999999999999998200001203789
Q gi|254780494|r    6 ARSKSEESLLKLSICMTIFMASVNLIIGTIT--------NSSSIVFDGFYSYLEAGMTALSLLVAKLIARDVSKVDYRER   77 (314)
Q Consensus         6 ~~~~~e~~~L~~sl~~~~~~a~~~~~~g~~s--------gS~allada~~sl~D~~~~~~~l~~~~~~~~~~~~~~~k~~   77 (314)
                      -.|+.-+|.|--|.+.|+.+....+..+...        +..++.+--+|.+++.+...+.+.+.--....     ....
T Consensus       289 l~Q~DiKrlLAYSSisqiG~i~lglG~~~~~~~~g~~~l~~la~~~al~hl~nHa~fKalLFl~aG~v~~~-----tgt~  363 (644)
T PRK08667        289 LKEHDLKGLLAYSSIENIGIILMGIGLYVIFGVYGLDTLALLALGGALFHSLNHALFKSLLFLTAGSVVHA-----TGTR  363 (644)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----CCCE
T ss_conf             97621899999999999999999998743101135115678899999999999999999999998799997-----1870


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             643752045689999999999999999
Q gi|254780494|r   78 ERYFQFGFWHFEPMVLAFNSVILICVA  104 (314)
Q Consensus        78 ~~~~p~G~~r~E~l~~l~~~~~l~~~~  104 (314)
                      |-+.=-|..|..|..+....+-.+..+
T Consensus       364 ~i~~lgGL~k~mP~t~~~f~ig~lai~  390 (644)
T PRK08667        364 NIEKMGGLVKRMPYTSALFLVGAVSIA  390 (644)
T ss_pred             EHHHHCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             299968944321899999999999987


No 64 
>PRK04998 hypothetical protein; Provisional
Probab=26.38  E-value=40  Score=13.37  Aligned_cols=57  Identities=16%  Similarity=0.196  Sum_probs=33.0

Q ss_pred             HHCCCHHHHHHHHHHHHHCCC-CCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHH
Q ss_conf             530997899999999971576-115100016787046769999999988899861099999999999
Q gi|254780494|r  224 FQMTSPDLDSQVREALYPIVI-RHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEI  289 (314)
Q Consensus       224 l~~~~~~~~~~I~~~i~~~~~-v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i  289 (314)
                      +|.+.+++.++|.+++..+.. ...   ..+|..+.|+..-+.+.+.+.      +-++.+++=+++
T Consensus        21 mG~~~~~f~~~V~~iv~~h~p~d~~---~~~r~SskG~Y~Svtv~i~a~------s~~QL~~iY~~L   78 (88)
T PRK04998         21 MGLARPELVDQVVEVVQRHAPGDYT---PTVKPSSKGNYHSVSITITAT------SIEQVETLYEEL   78 (88)
T ss_pred             EECCCCHHHHHHHHHHHHHCCCCCC---CCCCCCCCCCEEEEEEEEEEC------CHHHHHHHHHHH
T ss_conf             9728701889999999987788778---414258898379999999987------999999999997


No 65 
>pfam07290 DUF1449 Protein of unknown function (DUF1449). This family consists of several bacterial proteins of around 210 residues in length. The function of this family is unknown.
Probab=26.11  E-value=40  Score=13.34  Aligned_cols=19  Identities=16%  Similarity=0.072  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHHHHHCCCHH
Q ss_conf             8999999999995309978
Q gi|254780494|r  212 AICTMKSATFEIFQMTSPD  230 (314)
Q Consensus       212 ~~~~~~~~~~~Ll~~~~~~  230 (314)
                      ++...|-..+.+-..-|.+
T Consensus       108 ~~~~~r~~~~~~A~ilPkd  126 (202)
T pfam07290       108 SVPAVHYASKIIAPWIPRD  126 (202)
T ss_pred             HHHHHHHHHHHHHHHCCCC
T ss_conf             9999999888888757866


No 66 
>COG1292 BetT Choline-glycine betaine transporter [Cell envelope biogenesis, outer membrane]
Probab=25.91  E-value=41  Score=13.32  Aligned_cols=24  Identities=13%  Similarity=0.157  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             998999999999999889999999
Q gi|254780494|r  196 VDSMVLMFICLFILPSAICTMKSA  219 (314)
Q Consensus       196 ~D~i~alii~l~ii~~~~~~~~~~  219 (314)
                      .-.+.++-.++.++..-+...|+.
T Consensus       472 ~~ii~alPF~~vll~~~~sl~k~l  495 (537)
T COG1292         472 AAIITALPFSLVLLVMMFSLIKDL  495 (537)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHH
T ss_conf             999997019999999999999999


No 67 
>COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms]
Probab=25.14  E-value=42  Score=13.23  Aligned_cols=15  Identities=13%  Similarity=0.242  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             999999999998654
Q gi|254780494|r  282 LDAIRHEIGNAIGGL  296 (314)
Q Consensus       282 ~~~i~~~i~~~l~~~  296 (314)
                      .+.+.+++.+++.+.
T Consensus       623 ~~~~~~~~~~~~~~~  637 (1009)
T COG0841         623 AQAIIARLTKELAKI  637 (1009)
T ss_pred             HHHHHHHHHHHHHCC
T ss_conf             789999999875047


No 68 
>pfam09580 Spore_YhcN_YlaJ Sporulation lipoprotein YhcN/YlaJ (Spore_YhcN_YlaJ). This entry contains YhcN and YlaJ, which are predicted lipoproteins that have been detected as spore proteins but not vegetative proteins in Bacillus subtilis. Both appear to be expressed under control of the RNA polymerase sigma-G factor. The YlaJ-like members of this family have a low-complexity, strongly acidic, 40-residue C-terminal domain.
Probab=24.02  E-value=44  Score=13.10  Aligned_cols=67  Identities=7%  Similarity=0.150  Sum_probs=42.7

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             9999999971576115100016787046769999999988899861099999999999999865489219999985476
Q gi|254780494|r  232 DSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFTTQK  310 (314)
Q Consensus       232 ~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~~~~  310 (314)
                      -++|.+.+.+.++|.+     ..+.-+|...+|-+++.  .+    .-...+++++++++++++..|.. -++--+.||
T Consensus        68 A~~i~~~~~~~~~V~d-----A~vvVt~~~a~V~v~~~--~~----~~~~~~~ik~~V~~~v~~~~p~~-~~VyVs~D~  134 (169)
T pfam09580        68 ADKIARRVAKLPEVED-----AAVVVTGEEALVAVDLD--NG----ERSLTEEIKKQVKKAVKSVDPRI-YNVYVSADP  134 (169)
T ss_pred             HHHHHHHHHCCCCCCE-----EEEEEECCEEEEEEECC--CC----CHHHHHHHHHHHHHHHHHCCCCC-CEEEEECCH
T ss_conf             9999999961788644-----68999899799999738--86----40358999999999998408886-569996698


No 69 
>PRK12704 phosphodiesterase; Provisional
Probab=23.17  E-value=46  Score=13.00  Aligned_cols=62  Identities=15%  Similarity=0.099  Sum_probs=36.2

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHH---CCCEEEEEE
Q ss_conf             9999999715761151000167870467699999999888998610999999999999998654---892199999
Q gi|254780494|r  233 SQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGL---GEERWLTIS  305 (314)
Q Consensus       233 ~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~---~~~~~~~i~  305 (314)
                      .++.++...++||..     ....+-|+.+    -|.|+|+.-  +=.++..+.++|.+++++.   |+++.+||-
T Consensus       381 ~~lE~ia~~~~gV~~-----~yaiqaGREv----RV~V~p~~v--~D~~~~~la~~Ia~~Ie~e~~yPG~Ikvtvi  445 (455)
T PRK12704        381 EKLEEIAESFEGVEK-----AYAIQAGREI----RVIVKPDLV--DDLQAVLLARDIAKKIEEELQYPGQIKVTVI  445 (455)
T ss_pred             HHHHHHHHCCCCHHH-----HHHHHCCCEE----EEEECCCCC--CHHHHHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             999999835985788-----8877439769----999786767--8488999999999999973839973799998


No 70 
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.   Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits this transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L. lactis functionally complements an Escherichia coli proU mutant. The complementing locus is similar to a opuA locus in Bacillus subtlis. This clarifies the differences in nomenclature.; GO: 0005524 ATP binding, 0015171 amino acid transmembrane transporter activity, 0006865 amino acid transport, 0016020 membrane.
Probab=23.13  E-value=40  Score=13.35  Aligned_cols=93  Identities=17%  Similarity=0.140  Sum_probs=46.7

Q ss_pred             HHHHHHHHHHHHHH--CCCHHHH-HHHHHHHHHCCCCCCCEEEEEEEEEECC--------EEEEEEEE-EECCCCCHHHH
Q ss_conf             89999999999953--0997899-9999999715761151000167870467--------69999999-98889986109
Q gi|254780494|r  212 AICTMKSATFEIFQ--MTSPDLD-SQVREALYPIVIRHGFLDFYTYVTKVGR--------SRIIEIYL-IVPAHYPIKRI  279 (314)
Q Consensus       212 ~~~~~~~~~~~Ll~--~~~~~~~-~~I~~~i~~~~~v~~v~~~~i~~~~~G~--------~~~vev~i-~v~~~~~~~~~  279 (314)
                      |=.++.+|..-=+.  ..|.+.. ++-++.++-+.--.+..+-+=+-..-|.        -+..|=++ -+|+.-     
T Consensus        84 PHmTil~N~~~g~~L~g~~~~~R~ekAle~LklVglGe~y~~~YPdeLSGG~qQRvGl~RALa~~PdilLMDEaF-----  158 (372)
T TIGR01186        84 PHMTILQNTSLGLELLGIPEQERKEKALELLKLVGLGEEYEHRYPDELSGGMQQRVGLARALAAEPDILLMDEAF-----  158 (372)
T ss_pred             CCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEECCCCC-----
T ss_conf             641577787774775188677889999987641579876011586201487305899999874387805404764-----


Q ss_pred             HHHHH-HHHHHHHHHHHHCCCEEEEEEE-ECC
Q ss_conf             99999-9999999986548921999998-547
Q gi|254780494|r  280 ASLDA-IRHEIGNAIGGLGEERWLTISF-TTQ  309 (314)
Q Consensus       280 ~e~~~-i~~~i~~~l~~~~~~~~~~i~F-~~~  309 (314)
                      ...|- +|+++|++|.+.....+=||.| |||
T Consensus       159 sALDPliR~~lQdEl~kLq~~~~kTIvFitHD  190 (372)
T TIGR01186       159 SALDPLIRDSLQDELKKLQATLQKTIVFITHD  190 (372)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHCCEEEEEECC
T ss_conf             33571001678899999998609808999417


No 71 
>PRK08376 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=23.03  E-value=46  Score=12.98  Aligned_cols=24  Identities=17%  Similarity=0.163  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999998
Q gi|254780494|r   42 VFDGFYSYLEAGMTALSLLVAKLI   65 (314)
Q Consensus        42 lada~~sl~D~~~~~~~l~~~~~~   65 (314)
                      ..|++..+.-....++.+.+..++
T Consensus        82 ~vD~ls~~~~ll~~~i~~l~~lys  105 (513)
T PRK08376         82 EVDKFGAFMVLIAAIVSFLAVLYS  105 (513)
T ss_pred             EECHHHHHHHHHHHHHHHHHHHHH
T ss_conf             662766999999999999999995


No 72 
>PRK00092 hypothetical protein; Reviewed
Probab=22.86  E-value=46  Score=12.96  Aligned_cols=64  Identities=16%  Similarity=0.261  Sum_probs=43.2

Q ss_pred             HHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9999999971576115100016787046769999999988899861099999999999999865489
Q gi|254780494|r  232 DSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGE  298 (314)
Q Consensus       232 ~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~  298 (314)
                      .++|++.+..+-...++....+...+.|+...+.+.|.=+...   ++.+...+.+.+...|....+
T Consensus         3 ~e~i~~li~pvv~~~G~~L~dve~~~~~~~~~lrI~ID~~~gv---~lddc~~vSr~is~~LD~~d~   66 (153)
T PRK00092          3 EEQLTELIEPVVEGLGYELVGVEFVKAGRPSTLRIYIDSDGGI---TLDDCEDVSRQLSAVLDVEDP   66 (153)
T ss_pred             HHHHHHHHHHHHHHCCCEEEEEEEEECCCCEEEEEEEECCCCC---CHHHHHHHHHHHHHHHCCCCC
T ss_conf             8999999999998779999999999189973999999889991---899999988998875263656


No 73 
>pfam10934 DUF2634 Protein of unknown function (DUF2634). Some members in this family of proteins are annotated as phage related, xkdS however currently there is no known function.
Probab=22.34  E-value=48  Score=12.90  Aligned_cols=49  Identities=16%  Similarity=0.067  Sum_probs=34.2

Q ss_pred             HHHHHHC-CCH-----HHHHHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEE
Q ss_conf             9999530-997-----89999999997157611510001678704676999999998
Q gi|254780494|r  220 TFEIFQM-TSP-----DLDSQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIV  270 (314)
Q Consensus       220 ~~~Ll~~-~~~-----~~~~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v  270 (314)
                      ...|+|. .|+     |+...|+++++..|.+.++++..+.  +.|+.+.++..|.-
T Consensus        53 l~~liG~~~~~~~~~sEi~R~I~EaLl~d~rI~~V~nf~f~--~~~~~l~v~f~V~t  107 (112)
T pfam10934        53 LEDLIGKIYSKDYVESEVKRMIEEALLVDPRIKDVDNFEFE--KEKDSLYVSFTVIT  107 (112)
T ss_pred             HHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEE--EECCEEEEEEEEEE
T ss_conf             99984777898999999999999998549874437428999--97899999999999


No 74 
>PRK12705 hypothetical protein; Provisional
Probab=22.20  E-value=48  Score=12.88  Aligned_cols=63  Identities=16%  Similarity=0.094  Sum_probs=39.4

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHH---H-CCCEEEEEEE
Q ss_conf             999999971576115100016787046769999999988899861099999999999999865---4-8921999998
Q gi|254780494|r  233 SQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGG---L-GEERWLTISF  306 (314)
Q Consensus       233 ~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~---~-~~~~~~~i~F  306 (314)
                      ++++++...++||..     ....+.|+.+-    |.|+|+.-  +=.++..+.++|.+++++   . |+++.+|+--
T Consensus       410 ~~LE~Ia~~f~GV~k-----ayAiQAGREvR----V~V~p~~v--~D~~~~~La~~Ia~kIee~el~yPG~IKVtvIR  476 (485)
T PRK12705        410 EELEQIAESFPGVEK-----AYAIQSGRELR----VIVDNEKI--SDAQLTLLARDIKSKIEENDLTYPGPIKVTLIR  476 (485)
T ss_pred             HHHHHHHHCCCCHHH-----HHHHHCCCEEE----EEECCCCC--CHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             999999853885377-----86542486799----99778867--848899999999999888438689835999996


No 75 
>PRK10524 prpE propionyl-CoA synthetase; Provisional
Probab=22.10  E-value=48  Score=12.87  Aligned_cols=73  Identities=8%  Similarity=-0.002  Sum_probs=34.2

Q ss_pred             HHHHHHHHHCCCCCCCEEEEEEEEEECCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE--EEEEE
Q ss_conf             9999999715761151000167870467699999999888998610999999999999998654892199--99985
Q gi|254780494|r  233 SQVREALYPIVIRHGFLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWL--TISFT  307 (314)
Q Consensus       233 ~~I~~~i~~~~~v~~v~~~~i~~~~~G~~~~vev~i~v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~--~i~F~  307 (314)
                      .+|++++.++|+|.+.-..-+---..|...  -+.|++.+.....+-+....++++|.+.+++..+..++  .|.|.
T Consensus       509 ~EIE~~L~~hp~V~eaaVVgvpd~~~Ge~~--~afVvl~~g~~~~~~~~~~~l~~~i~~~~~~~l~~~~vP~~i~~v  583 (629)
T PRK10524        509 REIEESISSHPNVAEVAVVGVKDALKGQVA--VAFVVLKDSDTLADREARRALEKEIMALVDSQLGAVARPARVWFV  583 (629)
T ss_pred             HHHHHHHHHCCCCCEEEEEEEECCCCCCEE--EEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEC
T ss_conf             999999984989145899923758899489--999998888777723557999999999999767998577389990


No 76 
>TIGR01009 rpsC_bact ribosomal protein S3; InterPro: IPR005704   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .    Ribosomal protein S3 is one of the proteins from the small ribosomal subunit. This family describes the bacterial type of ribosomal protein S3 and also and many chloroplast forms. Chloroplast and mitochondrial forms have large, variable inserts between conserved N-terminal and C-terminal domains. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015935 small ribosomal subunit.
Probab=21.95  E-value=48  Score=12.85  Aligned_cols=78  Identities=14%  Similarity=0.211  Sum_probs=52.2

Q ss_pred             HHHHHHHHHHHHCCC--CCCCEEEEEEEEEECCE-EEEEEEEEECCCCCH-HHHHHHHHHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             899999999971576--11510001678704676-999999998889986-10999999999999998654892199999
Q gi|254780494|r  230 DLDSQVREALYPIVI--RHGFLDFYTYVTKVGRS-RIIEIYLIVPAHYPI-KRIASLDAIRHEIGNAIGGLGEERWLTIS  305 (314)
Q Consensus       230 ~~~~~I~~~i~~~~~--v~~v~~~~i~~~~~G~~-~~vev~i~v~~~~~~-~~~~e~~~i~~~i~~~l~~~~~~~~~~i~  305 (314)
                      ..|.+||+.+...+.  ..++-+..+  -+.-++ +.|.+|--=| ..-+ +.=.|+|.++++|++.+... -+++++|.
T Consensus        35 ~ED~KIR~~i~k~l~~~~a~iS~veI--eR~~~~~v~V~IhtArP-g~vIGkkG~~iE~l~~~l~k~~~~~-k~v~i~I~  110 (217)
T TIGR01009        35 HEDLKIRNLIKKELKKKNAGISDVEI--ERTADKKVRVTIHTARP-GIVIGKKGSEIEKLKKALQKLTGSV-KEVQINIK  110 (217)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCEEEE--EECCCCEEEEEEEECCC-CEEECCCCCHHHHHHHHHHHHHCCE-EEEEEEEE
T ss_conf             64389999873211335433132799--81699788999982788-6588578845899999999884783-58999898


Q ss_pred             EECCCC
Q ss_conf             854765
Q gi|254780494|r  306 FTTQKK  311 (314)
Q Consensus       306 F~~~~~  311 (314)
                      =...|+
T Consensus       111 EVk~p~  116 (217)
T TIGR01009       111 EVKRPE  116 (217)
T ss_pred             ECCCCC
T ss_conf             748857


No 77 
>PRK00701 manganese transport protein MntH; Reviewed
Probab=21.95  E-value=48  Score=12.85  Aligned_cols=90  Identities=16%  Similarity=0.104  Sum_probs=37.9

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHCCCCCC--CCH-HHHHHHHHHHHHHHH-HHHHHH---HH
Q ss_conf             5204568999999999999999999999------9999851479876--511-799999999998668-899876---41
Q gi|254780494|r   82 QFGFWHFEPMVLAFNSVILICVALYEFL------ISILNIISGGHDI--NFE-KAVIYSCVASFICLM-MGVYEN---RC  148 (314)
Q Consensus        82 p~G~~r~E~l~~l~~~~~l~~~~~~i~~------~si~~l~~~~~~~--~~~-~~~i~~~~~~~~~~~-l~~~~~---~~  148 (314)
                      .||+.++|.+...+.+++.+......+.      +-.+.++ |..+.  +.. ...+.+.++..+.-. +++...   +.
T Consensus       162 ~~~~~~~E~~~~~lv~~m~l~F~~~~~~~~P~~~~v~~g~v-P~~~~~~~~~~~~~~iaiiGtTV~P~~lfl~sslv~~~  240 (438)
T PRK00701        162 RRGFRPLEAIVGGLLLVIAACFIVELFLAQPDWAAVLKGFI-PSSEILTNPEALYLAAGILGATVMPHNLYLHSSLVQTR  240 (438)
T ss_pred             HCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCC-CCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHC
T ss_conf             36853599999999999999999999711888999985516-88767898128999999926245035999999998734


Q ss_pred             HCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             035777999999987578874213
Q gi|254780494|r  149 NREIKSDFIALDAKSWIVAGYLLL  172 (314)
Q Consensus       149 ~~~~~s~~l~~~~~~~~~D~~~s~  172 (314)
                      ..+.+....+...+..+.|...+.
T Consensus       241 ~~~~~~~~~~~~l~~~r~Dt~~~~  264 (438)
T PRK00701        241 VYGRTGEEKREALRFTRIDSTIAL  264 (438)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             678873779999999999999999


No 78 
>pfam01566 Nramp Natural resistance-associated macrophage protein. The natural resistance-associated macrophage protein (NRAMP) family consists of Nramp1, Nramp2, and yeast proteins Smf1 and Smf2. The NRAMP family is a novel family of functional related proteins defined by a conserved hydrophobic core of ten transmembrane domains. This family of membrane proteins are divalent cation transporters. Nramp1 is an integral membrane protein expressed exclusively in cells of the immune system and is recruited to the membrane of a phagosome upon phagocytosis. By controlling divalent cation concentrations Nramp1 may regulate the interphagosomal replication of bacteria. Mutations in Nramp1 may genetically predispose an individual to susceptibility to diseases including leprosy and tuberculosis conversely this might however provide protection form rheumatoid arthritis. Nramp2 is a multiple divalent cation transporter for Fe2+, Mn2+ and Zn2+ amongst others it is expressed at high levels in the inte
Probab=21.92  E-value=48  Score=12.84  Aligned_cols=91  Identities=11%  Similarity=0.017  Sum_probs=43.2

Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHH----HCCCCCCCCHHHHHHHHHHHHHHHHHHHH-HH----HHHC
Q ss_conf             5204568999999999999999999999--999985----14798765117999999999986688998-76----4103
Q gi|254780494|r   82 QFGFWHFEPMVLAFNSVILICVALYEFL--ISILNI----ISGGHDINFEKAVIYSCVASFICLMMGVY-EN----RCNR  150 (314)
Q Consensus        82 p~G~~r~E~l~~l~~~~~l~~~~~~i~~--~si~~l----~~~~~~~~~~~~~i~~~~~~~~~~~l~~~-~~----~~~~  150 (314)
                      ..||.++|.+.....+++.+......+.  -.....    ..|..+.......+.+.++..+.....++ ..    |...
T Consensus       110 ~~~y~~~E~~~~~lv~~m~~~f~~~~~~~~P~~~~i~~g~~~P~~~~~~~~~~~~aiiGttv~p~~~f~~s~~~~~k~~~  189 (365)
T pfam01566       110 RGGYRRLERVIIALVAVIALSFIAELFLVKPDWGEVAAGLVVPSLPGSGSLLLAIAILGATVMPHNLFLHSSLVQERGWT  189 (365)
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCC
T ss_conf             17707899999999999999999999602888999961457888998418999999982100058999999999855577


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             5777999999987578874213
Q gi|254780494|r  151 EIKSDFIALDAKSWIVAGYLLL  172 (314)
Q Consensus       151 ~~~s~~l~~~~~~~~~D~~~s~  172 (314)
                      ..+....+.+.+..+.|...+.
T Consensus       190 ~~~~~~~~~~l~~~r~D~~~g~  211 (365)
T pfam01566       190 IRDPASIREALRYARIDTIIAL  211 (365)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHH
T ss_conf             7753668999999999999999


No 79 
>pfam07690 MFS_1 Major Facilitator Superfamily.
Probab=21.59  E-value=49  Score=12.80  Aligned_cols=45  Identities=9%  Similarity=0.113  Sum_probs=27.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-CCCHHHHHHHHHHHH
Q ss_conf             998999999999999889999999999953-099789999999997
Q gi|254780494|r  196 VDSMVLMFICLFILPSAICTMKSATFEIFQ-MTSPDLDSQVREALY  240 (314)
Q Consensus       196 ~D~i~alii~l~ii~~~~~~~~~~~~~Ll~-~~~~~~~~~I~~~i~  240 (314)
                      .+......++.++...+..........+.. ..|+|...+......
T Consensus       289 ~~~~~~~~~~~~i~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~  334 (345)
T pfam07690       289 TESSLWLLVALLLLGFGAGLVFPALNALASDLAPKEERGTASGLYN  334 (345)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             1219999999999999999999999999998789989999999999


No 80 
>TIGR00657 asp_kinases aspartate kinase; InterPro: IPR001341   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   Aspartate kinase (2.7.2.4 from EC) (AK) catalyzes the first reaction in the aspartate pathway; the phosphorylation of aspartate. The product of this reaction can then be used in the biosynthesis of lysine or in the pathway leading to homoserine, which participates in the biosynthesis of threonine, isoleucine and methionine .   In bacteria there are three different aspartate kinase isozymes which differ in sensitivity to repression and inhibition by Lys, Met and Thr. AK1 and AK2 are bifunctional enzymes which both consist of an N-terminal AK domain and a C-terminal homoserine dehydrogenase domain. AK1 is involved in threonine biosynthesis and AK2, in that of methionine. The third isozyme, AK3 is monofunctional and involved in lysine synthesis. In archaea and plants there may be a single isozyme of AK which in plants is multifunctional.   This entry represents a region encoding aspartate kinase activity found in both the monofunctional and bifunctional enzymes.   Synonym(s): Aspartokinase; GO: 0004072 aspartate kinase activity, 0008652 amino acid biosynthetic process.
Probab=21.38  E-value=42  Score=13.25  Aligned_cols=28  Identities=14%  Similarity=0.140  Sum_probs=21.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEE--EEECCCCC
Q ss_conf             99999999865489219999--98547655
Q gi|254780494|r  285 IRHEIGNAIGGLGEERWLTI--SFTTQKKW  312 (314)
Q Consensus       285 i~~~i~~~l~~~~~~~~~~i--~F~~~~~~  312 (314)
                      -+-=|-.+|+..-.++|.+|  .||+|||.
T Consensus       223 tA~llA~aL~Ad~~~IyTDV~Gi~T~DPR~  252 (504)
T TIGR00657       223 TAALLAAALKADECEIYTDVDGIYTTDPRI  252 (504)
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCEECCCCC
T ss_conf             999999861996899987279503278863


No 81 
>PRK11670 putative ATPase; Provisional
Probab=20.67  E-value=51  Score=12.69  Aligned_cols=36  Identities=17%  Similarity=0.015  Sum_probs=20.3

Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             88899861099999999999999865489219999985
Q gi|254780494|r  270 VPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFT  307 (314)
Q Consensus       270 v~~~~~~~~~~e~~~i~~~i~~~l~~~~~~~~~~i~F~  307 (314)
                      -+++.+  ....+.++++++-.++.-.....--+|.|.
T Consensus       332 ~~P~S~--aA~Af~~iA~~la~~~~~~~~~~~~~~~~~  367 (369)
T PRK11670        332 SRPESE--FTAIYRQLADRVAAQLYWQGEVIPGEISFR  367 (369)
T ss_pred             ECCCCH--HHHHHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             289998--999999999999999965146899752776


No 82 
>PRK12667 putative monovalent cation/H+ antiporter subunit D; Reviewed
Probab=20.61  E-value=52  Score=12.68  Aligned_cols=25  Identities=12%  Similarity=-0.035  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999999999999999982
Q gi|254780494|r   42 VFDGFYSYLEAGMTALSLLVAKLIA   66 (314)
Q Consensus        42 lada~~sl~D~~~~~~~l~~~~~~~   66 (314)
                      ..|++-.+.-....++.+.+..++.
T Consensus        79 ~vD~ls~~~~ll~~~v~~l~~lys~  103 (517)
T PRK12667         79 EVDLLGALIGLLTALLMFLILIYSY  103 (517)
T ss_pred             EEHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5417369999999999999999999


No 83 
>PRK07363 NAD(P)H-quinone oxidoreductase subunit M; Validated
Probab=20.25  E-value=52  Score=12.63  Aligned_cols=19  Identities=5%  Similarity=0.013  Sum_probs=9.4

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q ss_conf             9899999999999988999
Q gi|254780494|r  197 DSMVLMFICLFILPSAICT  215 (314)
Q Consensus       197 D~i~alii~l~ii~~~~~~  215 (314)
                      -|.++.+.+..+.+.+.-.
T Consensus       236 p~~~s~llsg~~~K~G~y~  254 (499)
T PRK07363        236 SPAVAILLGGVLAKLGTYG  254 (499)
T ss_pred             CCCCHHHHHHHHHHHHHHH
T ss_conf             9861156589999999999


No 84 
>PRK09672 phage exclusion protein Lit; Provisional
Probab=20.25  E-value=52  Score=12.63  Aligned_cols=46  Identities=17%  Similarity=0.143  Sum_probs=35.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCC
Q ss_conf             9999999998899999999999530997899999999971576115
Q gi|254780494|r  202 MFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHG  247 (314)
Q Consensus       202 lii~l~ii~~~~~~~~~~~~~Ll~~~~~~~~~~I~~~i~~~~~v~~  247 (314)
                      ..+++.+....+..++...+.+.+.+-|+..++|...+..++..++
T Consensus       206 ~~vaIa~~ll~i~~i~~~l~g~~~~THP~~~~RI~~~is~i~~~e~  251 (296)
T PRK09672        206 RIVAIATALLAIQSLELDLKGCFGGTHPDVSNRIFANLSQISEIED  251 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCH
T ss_conf             6899999999996215330677789896678899842430686511


Done!