BLAST/PSIBLAST alignment of GI: 254780494 and GI: 26987962 at iteration 1
>gi|26987962|ref|NP_743387.1| cation efflux protein [Pseudomonas putida KT2440] Length = 319
>gi|148546499|ref|YP_001266601.1| cation efflux protein [Pseudomonas putida F1] Length = 319
>gi|24982675|gb|AAN66851.1|AE016313_10 membrane protein, putative [Pseudomonas putida KT2440] Length = 319
>gi|148510557|gb|ABQ77417.1| cation efflux protein [Pseudomonas putida F1] Length = 319
 Score =  259 bits (661), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 128/306 (41%), Positives = 187/306 (61%), Gaps = 3/306 (0%)

Query: 10  SEESLLKLSICMTIFMASVNLIIGTITNSSSIVFDGFYSYLEAGMTALSLLVAKLIARDV 69
           SE+ LL+ SI  T+F+A++ +  G  + S SIVFDG YS ++A M+ LSL+V KLI    
Sbjct: 14  SEQGLLRTSIAATLFIATIGIAFGLASGSFSIVFDGVYSLVDASMSGLSLVVVKLITSHT 73

Query: 70  SKVDYRE--RERYFQFGFWHFEPMVLAFNSVILICVALYEFLISILNIISGGHDINFEKA 127
           + V      RER F  GFWH EPMVLA N ++L  VA+Y  + ++ +++ GG  + F  A
Sbjct: 74  TSVQMSRKLRER-FTMGFWHLEPMVLALNGILLGGVAIYALINAVSSLLQGGRHLEFGIA 132

Query: 128 VIYSCVASFICLMMGVYENRCNREIKSDFIALDAKSWIVAGYLLLAVVIAFLCAMLLRDS 187
           ++Y+ +    C+ + V E R NR++KSDF+ +D K W+++  +  A++IAF     ++ +
Sbjct: 133 MVYAALTVITCVTIAVIEARANRKLKSDFVRMDVKGWVMSASITAALLIAFCFGYAVQGT 192

Query: 188 AYDWIIPYVDSMVLMFICLFILPSAICTMKSATFEIFQMTSPDLDSQVREALYPIVIRHG 247
           A +W+ PY+D  VL  +CL I+P  +  ++ A  EIF +T  DL   V E     V RHG
Sbjct: 193 ALEWVSPYIDPAVLALVCLVIVPLPMSVVRQALSEIFLVTPGDLKLHVDEVAKAFVARHG 252

Query: 248 FLDFYTYVTKVGRSRIIEIYLIVPAHYPIKRIASLDAIRHEIGNAIGGLGEERWLTISFT 307
              +  YV KVGRSR IE+Y IVP     K I   DA R+EIG+A+GG G +RWLT+ FT
Sbjct: 253 LQSYRAYVAKVGRSREIELYFIVPKTMAAKTIDEWDAWRNEIGDAVGGEGPDRWLTVVFT 312

Query: 308 TQKKWA 313
              +WA
Sbjct: 313 GDPEWA 318