RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780495|ref|YP_003064908.1| superoxide dismutase [Candidatus Liberibacter asiaticus str. psy62] (205 letters) >gnl|CDD|30950 COG0605, SodA, Superoxide dismutase [Inorganic ion transport and metabolism]. Length = 204 Score = 236 bits (603), Expect = 4e-63 Identities = 100/202 (49%), Positives = 132/202 (65%), Gaps = 4/202 (1%) Query: 1 MDFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEML--HLSLEEIII 58 M ++LP LPY+YD L P++S ET+E HHD HH+ Y +N LSLEEII Sbjct: 2 MAYELPELPYAYDALEPHISAETMELHHDKHHQTYVNNLNAALEGLTEELEDLSLEEIIK 61 Query: 59 KSHGSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITA 118 K G A LFNNA ++NH+LFW + G GK L+ AI+ +FGSF+KFK + A Sbjct: 62 KLAGLPAALFNNAGGHWNHSLFWENLSPGGGGGKPTGELAAAINKDFGSFDKFKEEFTAA 121 Query: 119 ASTQFGSGWGWLSVK-NGKLEISKTQNAENPLINGAIPILGIDVWEHAYYLDFKYRRAHY 177 A++ FGSGW WL +GKLEI T N + PL+ G++P+LG+DVWEHAYYLD+ RR Y Sbjct: 122 AASVFGSGWAWLVYDPDGKLEIVSTYNQDTPLMWGSVPLLGLDVWEHAYYLDYGNRRPDY 181 Query: 178 IESFITNLVNWEYVCERYETAM 199 +E+F N+VNW+ V ER+E A Sbjct: 182 VEAFW-NVVNWDEVEERFEAAK 202 >gnl|CDD|36094 KOG0876, KOG0876, KOG0876, Manganese superoxide dismutase [Inorganic ion transport and metabolism]. Length = 234 Score = 186 bits (473), Expect = 4e-48 Identities = 84/203 (41%), Positives = 113/203 (55%), Gaps = 8/203 (3%) Query: 3 FKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH- 61 LP+LPY YD L P +S E +E H D HH+ Y +N K L+ L + + Sbjct: 28 ATLPDLPYDYDALEPIISAEIMELHWDKHHRTYVNNLNKAVEGLSELYSKLFVELSLTAI 87 Query: 62 -GSNAGLFNNASQYYNHNLFWACMKKNDGKGKVPQALSDAIDDNFGSFEKFKSDLITAAS 120 A FN A YNH+ FW + G +AL AID +FGS E+F +L AA+ Sbjct: 88 APQPAPKFNGAGHIYNHSFFWENLAPPGGGKPEGEALLKAIDSSFGSLEEFVKELNAAAA 147 Query: 121 TQFGSGWGWL--SVKNGKLEISKTQNAENPLI---NGAIPILGIDVWEHAYYLDFKYRRA 175 FGSGW WL + + KL I T NA +PL+ +P+LGIDVWEHAYYLD+ RA Sbjct: 148 AVFGSGWLWLVYNKELKKLFILTTYNAGDPLVWTTGQLVPLLGIDVWEHAYYLDYGNVRA 207 Query: 176 HYIESFITNLVNWEYVCERYETA 198 YI++ +++NW+ V ER+E A Sbjct: 208 EYIKAIW-DVINWKVVSERFEAA 229 >gnl|CDD|145761 pfam02777, Sod_Fe_C, Iron/manganese superoxide dismutases, C-terminal domain. superoxide dismutases (SODs) catalyse the conversion of superoxide radicals to hydrogen peroxide and molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the Mn/Fe-binding family is one. In humans, there is a cytoplasmic Cu/Zn SOD, and a mitochondrial Mn/Fe SOD. C-terminal domain is a mixed alpha/beta fold. Length = 105 Score = 138 bits (349), Expect = 1e-33 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 3/101 (2%) Query: 96 ALSDAIDDNFGSFEKFKSDLITAASTQFGSGWGWLSVK--NGKLEISKTQNAENPLINGA 153 L++AID++FGSF+KFK + AA+ FGSGW WL +GKL I T N +NPL G Sbjct: 6 ELAEAIDEDFGSFDKFKEEFTAAAAGLFGSGWAWLVYDPESGKLRIVSTPNQDNPLTTGL 65 Query: 154 IPILGIDVWEHAYYLDFKYRRAHYIESFITNLVNWEYVCER 194 P+L +DVWEHAYYLD++ RR Y+++F N+VNW+ V +R Sbjct: 66 TPLLTLDVWEHAYYLDYQNRRPDYLKAFW-NVVNWDEVAKR 105 >gnl|CDD|109149 pfam00081, Sod_Fe_N, Iron/manganese superoxide dismutases, alpha-hairpin domain. superoxide dismutases (SODs) catalyse the conversion of superoxide radicals to hydrogen peroxide and molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the Mn/Fe-binding family is one. In humans, there is a cytoplasmic Cu/Zn SOD, and a mitochondrial Mn/Fe SOD. N-terminal domain is a long alpha antiparallel hairpin. A small fragment of YTRE_LEPBI matches well - sequencing error?. Length = 82 Score = 95.0 bits (237), Expect = 1e-20 Identities = 35/84 (41%), Positives = 48/84 (57%), Gaps = 2/84 (2%) Query: 2 DFKLPNLPYSYDDLSPYMSKETLEYHHDVHHKNYADNALKLASDAEMLHLSLEEIIIKSH 61 ++LP+LPY YD L P++SKET+E HH HH+ Y +N E LEEII+K Sbjct: 1 KYELPDLPYDYDALEPHISKETMEIHHGKHHQTYVNNLNAALEGLEEARKKLEEIILK-- 58 Query: 62 GSNAGLFNNASQYYNHNLFWACMK 85 LFNN ++NH+ FW + Sbjct: 59 ALLGALFNNGGGHWNHSFFWKNLS 82 >gnl|CDD|48153 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings. In contrast to bacterial group I chaperonins (GroEL), each ring of the eukaryotic cytosolic chaperonin (CTT) consists of eight different, but homologous subunits. Their common function is to sequester nonnative proteins inside their central cavity and promote folding by using energy derived from ATP hydrolysis. The best studied in vivo substrates of CTT are actin and tubulin.. Length = 517 Score = 30.2 bits (68), Expect = 0.42 Identities = 10/31 (32%), Positives = 15/31 (48%) Query: 95 QALSDAIDDNFGSFEKFKSDLITAASTQFGS 125 +AL + D+ E F+ DL+ A T S Sbjct: 129 EALLSSAVDHSSDEEAFREDLLNIARTTLSS 159 >gnl|CDD|29359 cd01937, ribokinase_group_D, Ribokinase-like subgroup D. Found in bacteria and archaea, this subgroup is part of the ribokinase/pfkB superfamily. Its oligomerization state is unknown at this time.. Length = 254 Score = 29.5 bits (66), Expect = 0.60 Identities = 12/73 (16%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Query: 22 ETLEYHHDVHHKNY-ADNALKLASDAEMLHLSLEEIIIKSHGSNAGLFNNASQYYNHNLF 80 L+ H + A+ A ++ + + II + G G + + Y Sbjct: 151 VILKLHDVLKLSRVEAEVISTPTELARLIKETGVKEIIVTDGEEGGYIFDGNGKYTIPAS 210 Query: 81 WACMKKNDGKGKV 93 + G G V Sbjct: 211 KKDVVDPTGAGDV 223 >gnl|CDD|34591 COG4986, COG4986, ABC-type anion transport system, duplicated permease component [Inorganic ion transport and metabolism]. Length = 523 Score = 27.2 bits (60), Expect = 2.9 Identities = 30/135 (22%), Positives = 39/135 (28%), Gaps = 36/135 (26%) Query: 71 ASQYYNHNLFWACMKKNDGKGKVPQALSDAIDD-NFGSFEKFKS--------DLITAAST 121 + YY A G +P +A + N G + K++ LIT ST Sbjct: 395 GTFYYIFYNVIA------GAKALPVEYFEAAKNYNLGGWAKWRRIILPGTFPYLITGLST 448 Query: 122 QFGSGWGWLSVKN--------------GKLEISKTQNAENPLINGAIPILGIDV------ 161 G W L V GK T + P I+GI V Sbjct: 449 TIGGAWNALIVGEYWSWGHTLLVAHGLGKYIAVATAAGDIPRALWGSFIMGIVVVVYNIL 508 Query: 162 -WEHAYYLDFKYRRA 175 W L K A Sbjct: 509 FWRRLMDLARKRYVA 523 >gnl|CDD|35584 KOG0363, KOG0363, KOG0363, Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones]. Length = 527 Score = 27.2 bits (60), Expect = 3.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 95 QALSDAIDDNFGSFEKFKSDLITAASTQFGS 125 +AL+ + DN EKF+ DL+ A T S Sbjct: 134 EALTKSSIDNSSDKEKFREDLLKIARTTLSS 164 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.133 0.410 Gapped Lambda K H 0.267 0.0683 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,560,009 Number of extensions: 126702 Number of successful extensions: 277 Number of sequences better than 10.0: 1 Number of HSP's gapped: 267 Number of HSP's successfully gapped: 12 Length of query: 205 Length of database: 6,263,737 Length adjustment: 89 Effective length of query: 116 Effective length of database: 4,340,536 Effective search space: 503502176 Effective search space used: 503502176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 55 (25.1 bits)