HHsearch alignment for GI: 254780497 and conserved domain: CHL00203

>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional.
Probab=100.00  E-value=0  Score=538.56  Aligned_cols=315  Identities=42%  Similarity=0.767  Sum_probs=291.9

Q ss_pred             EEEEEEEEECCCCEECHHHHHHHHCCCHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             69999999649841178899988099987811024751889828988999999999999997402123544336650122
Q gi|254780497|r    4 STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATST   83 (324)
Q Consensus         4 ~~I~~~g~ylP~~~v~~~el~~~~~~~~~~i~~~~GI~~R~~~~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~   83 (324)
T Consensus         1 v~I~g~g~ylP~~~v~n~e~~~~~~~~~~~i~~~tGI~~R~~~~~~e~~sdma~~Aa~~aL~~ag~~~~dIDllI~~t~t   80 (327)
T CHL00203          1 VHILSTGSSVPNFSIENQQFSQIVETSDEWISTRTGIKKRRLAGSSTSLTKLAAEAANKALHKAGWSAKDIDLIILATST   80 (327)
T ss_pred             CEEEEEEEECCCCEECHHHHHHHCCCCHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEECCC
T ss_conf             97999999789917849999987299868885457940797789999999999999999997549997898889995004


Q ss_pred             CCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             33458985310011220268644442101220034678889989641556531676302243222456632323454431
Q gi|254780497|r   84 PDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAG  163 (324)
Q Consensus        84 ~~~~~p~~a~~i~~~LGl~~~~~~di~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~S~~~d~~d~~~~~lfGDGAa  163 (324)
T Consensus        81 pd~~~-~~a~~v~~~LG~~~~~afDv~~aC~g~~~al~~A~~~i~sg~~~~~LvV~~E~~S~~~~~~~~~~~~~fGDgA~  159 (327)
T CHL00203         81 PDDLF-GSASQLQAEIGATQAVAFDITAACSGFIFALVTAGQFIQSGSYRNILIIGADTLSRWIDWSDRRTCILFGDGAG  159 (327)
T ss_pred             CCCCC-CHHHHHHHHHCCCCCEEEEHHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHCCCCCE
T ss_conf             67678-76999999858998637655200447999999999998569845147851432357656464545311378524


Q ss_pred             EEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCEEECCCCCC----------CCCCCCHHHCCHHHHHHHHHHHHHHHHH
Q ss_conf             234402654465434454101232035555561775487654----------4433200103202444557777777888
Q gi|254780497|r  164 ALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPST----------SRTVGCIRMEGKAVFKYAVEKAVELIEK  233 (324)
Q Consensus       164 A~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~g~~~~~~~~~~~~~~i~~  233 (324)
T Consensus       160 A~il~~~~~~~-----~~~l~~~~~tdg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~v~~~~~~~~~~~i~~  234 (327)
T CHL00203        160 AVAIGECPTEE-----NSILGFKLCTDGSLNSHLQLMNKPDNMQLFNQTKYPMGGFNSISMNGKEVYKFAVFQVPAVIQE  234 (327)
T ss_pred             EEEEEECCCCC-----CCEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHHHH
T ss_conf             89874046777-----8447899986677776178724787766567665667885427875599999999999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEECC
Q ss_conf             89874001000121024444415899999971978767336586519330126999999999806889998999999714
Q gi|254780497|r  234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGG  313 (324)
Q Consensus       234 ~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e~~~~~~~~~Gn~~sas~~~~L~~~~~~g~l~~Gd~vll~~~G~  313 (324)
T Consensus       235 ~l~~~g~~~~did~~v~HQ~~~~~~~~i~~~lgl~~~k~~~~~~~~GNt~sasip~~L~~~~~~g~l~~Gd~vll~g~G~  314 (327)
T CHL00203        235 CLNALNISIDEVDWLLLHQANQRILEAVADRLSIPHSKMITNLEHYGNTSAASIPLALDEAIKDNKIQPGQIIVLSGFGA  314 (327)
T ss_pred             HHHHCCCCCCCCCEEEECCCCHHHHHHHHHHHCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCEEEEEEEEH
T ss_conf             99876998111887998868899999999981979788665476449668889999999999849999989999999855


Q ss_pred             CCCEEEEEEEC
Q ss_conf             50145687869
Q gi|254780497|r  314 GFTSGTVLLRW  324 (324)
Q Consensus       314 G~s~~a~llrw  324 (324)
T Consensus       315 G~s~g~~~~~w  325 (327)
T CHL00203        315 GLTWGAIVLKW  325 (327)
T ss_pred             HHHHEEEEEEE
T ss_conf             72026899997