HHsearch alignment for GI: 254780497 and conserved domain: COG0304

>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].
Probab=99.17  E-value=7.1e-10  Score=82.79  Aligned_cols=231  Identities=24%  Similarity=0.339  Sum_probs=132.9

Q ss_pred             CCEEEEEEEEEECCCCEECHHH-HHHHH-CCC-----HHHHHH----CC-C-CCE--EEEECC----CCCHHHHHHHHHH
Q ss_conf             9226999999964984117889-99880-999-----878110----24-7-518--898289----8899999999999
Q gi|254780497|r    1 MIRSTVRGIGLSLPRRVLSNSD-LESIV-DTS-----DGWIKR----RV-G-ISR--RHIAGK----DETTASLGEAAAR   61 (324)
Q Consensus         1 M~~~~I~~~g~ylP~~~v~~~e-l~~~~-~~~-----~~~i~~----~~-G-I~~--R~~~~~----~e~~~~la~~Aa~   61 (324)
T Consensus         2 ~~rVviTG~g~vs~lG~-~~~~~~~~l~~g~sgi~~~~~~~~~~~~~~~~g~i~~~~~~~~~~~~r~~d~~~~~a~~Aa~   80 (412)
T COG0304           2 MRRVVITGLGIVSSLGN-GVEEVWAALLAGKSGIRPITRFDASGLGVKIAGEIKDLDDQIAKKERRFMDRFSQLAVVAAV   80 (412)
T ss_pred             CCEEEEECCEEECCCCC-CHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCHHHHHCCCHHHHHHHHHHH
T ss_conf             86299943456313658-87999999865878877666456557787503433520101366766141589999999999


Q ss_pred             HHHHHHCCCC-CCCC--E-EEEECCCCCC----------------------C----CCC-CCCCHHHHHHCCCCCCCCCC
Q ss_conf             9997402123-5443--3-6650122334----------------------5----898-53100112202686444421
Q gi|254780497|r   62 DALHHAEMSV-DDID--L-IIVATSTPDQ----------------------T----FPS-TAVNIQNRLGMKRGFAFDMQ  110 (324)
Q Consensus        62 ~al~~a~~~~-~~Id--~-ii~~s~~~~~----------------------~----~p~-~a~~i~~~LGl~~~~~~di~  110 (324)
T Consensus        81 ~Al~dAgl~~~~~~~~r~gv~iGsg~gg~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~a~~vs~~~g~~-G~~~t~~  159 (412)
T COG0304          81 EALEDAGLDNELNVDMRVGVAIGSGIGGLEDIEFDLDALLLEGLRKRISPFLVPKMLPNLAAGNVAIVFGLK-GPNYTPV  159 (412)
T ss_pred             HHHHHCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCHHHHHHCCCHHHHHHHHHHCCC-CCCCCHH
T ss_conf             999975998433568627999931677841256678888752786676820566653514789999985877-8767806


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCEEEEECC-CC---------------C------CCCCCCC-CCCCCCCCCCCEEEE
Q ss_conf             01220034678889989641556531676302-24---------------3------2224566-323234544312344
Q gi|254780497|r  111 AVCSGFVYAVTTADSYIRSGVVRRVMVIGSDT-FS---------------R------IVDWSDR-STCVLFGDGAGALIL  167 (324)
Q Consensus       111 ~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~-~S---------------~------~~d~~d~-~~~~lfGDGAaA~ll  167 (324)
T Consensus       160 tACatg~~aIg~A~~~I~~G~ad~~iaGG~e~~i~~~~i~gF~a~~Alst~nd~p~~asrPfd~~RdGFV~gEGag~lVL  239 (412)
T COG0304         160 TACATGAHAIGDAVRLIRLGKADVVIAGGAEAAITPLGIAGFEAMRALSTRNDDPEKASRPFDKNRDGFVIGEGAGALVL  239 (412)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCEEEEEE
T ss_conf             66776888999999999739999899846533158989999998787567889953358888888997788540457886


Q ss_pred             ECCCCCCCCCCC--CCCEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             026544654344--541012320355555617754876544433200103202444557777777888898740010001
Q gi|254780497|r  168 EGVEVKGSSMAD--TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENI  245 (324)
Q Consensus       168 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~~di  245 (324)
T Consensus       240 E~~ehA~aRGA~Iyaei~G~g~~~Da-----~h~t~-----P~-----p~g--------~Ga~~am~~AL~~Agl~~~~i  296 (412)
T COG0304         240 EELEHALARGAKIYAEIVGYGTTSDA-----YHITA-----PA-----PDG--------EGAIRAMRAALADAGLTPEDI  296 (412)
T ss_pred             CCHHHHHHCCCCEEEEEEEEEECCCC-----CCCCC-----CC-----CCC--------CHHHHHHHHHHHHCCCCHHHC
T ss_conf             37624866899658999877731440-----13678-----99-----787--------569999999999849997679


Q ss_pred             CCCCCCCCCHH
Q ss_conf             21024444415
Q gi|254780497|r  246 DWFVPHQANWR  256 (324)
Q Consensus       246 d~~~~Hq~~~~  256 (324)
T Consensus       297 dYinaHgTsT~  307 (412)
T COG0304         297 DYINAHGTSTP  307 (412)
T ss_pred             CEEECCCCCCC
T ss_conf             98947876687