HHsearch alignment for GI: 254780497 and conserved domain: KOG1394

>KOG1394 consensus.
Probab=98.93  E-value=9.4e-09  Score=75.61  Aligned_cols=232  Identities=25%  Similarity=0.321  Sum_probs=136.7

Q ss_pred             CCEEEEEEEEEECCCCEECHHHHHHHHCCCHH----------HHHHC-CC-CCE----EEEECCCC----CHHHHHHHHH
Q ss_conf             92269999999649841178899988099987----------81102-47-518----89828988----9999999999
Q gi|254780497|r    1 MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDG----------WIKRR-VG-ISR----RHIAGKDE----TTASLGEAAA   60 (324)
Q Consensus         1 M~~~~I~~~g~ylP~~~v~~~el~~~~~~~~~----------~i~~~-~G-I~~----R~~~~~~e----~~~~la~~Aa   60 (324)
T Consensus        23 ~rRVVITGmG~VTplG~~v~~~w~~Ll~GesGI~~l~~~d~k~~p~~v~g~Ip~f~~e~~~s~~~~r~ms~~~~~al~aa  102 (440)
T KOG1394          23 MRRVVITGMGAVTPLGNGVHTSWRNLLSGESGISSLEGPDYKSIPFTVAGKIPRFSVEDYVSKGDERRMSKFTKLALTAA  102 (440)
T ss_pred             CEEEEEECCCEEECCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             30599955634202777757789876536667421466420247620113056633114436244666557899999999


Q ss_pred             HHHHHHHCCCCC---CCCE----EEEECCCC---------------------CCCCC----C-CCCCHHHHHHCCCCCCC
Q ss_conf             999974021235---4433----66501223---------------------34589----8-53100112202686444
Q gi|254780497|r   61 RDALHHAEMSVD---DIDL----IIVATSTP---------------------DQTFP----S-TAVNIQNRLGMKRGFAF  107 (324)
Q Consensus        61 ~~al~~a~~~~~---~Id~----ii~~s~~~---------------------~~~~p----~-~a~~i~~~LGl~~~~~~  107 (324)
T Consensus       103 ~eAL~da~~~~~~~~e~dk~~~GV~iGtgmg~l~~i~e~a~~~~~~g~rrvsPffVPkil~NM~ag~vsm~~gl~-Gpnh  181 (440)
T KOG1394         103 EEALKDAGLLDVNLSEEDKEKTGVLIGTGMGDLEDIYETAQNLSEKGYRRVSPFFVPKILTNMAAGYVSMKYGLR-GPNH  181 (440)
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHCEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCHHHHHHCCC-CCCH
T ss_conf             999973688886412455441045851463329999999999987223433863000665036510334531576-7761


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC---------------CC-CCC------CCCC-CCCCCCCCCCCE
Q ss_conf             421012200346788899896415565316763022---------------43-222------4566-323234544312
Q gi|254780497|r  108 DMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTF---------------SR-IVD------WSDR-STCVLFGDGAGA  164 (324)
Q Consensus       108 di~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~---------------S~-~~d------~~d~-~~~~lfGDGAaA  164 (324)
T Consensus       182 svSTACATg~h~igda~n~Ir~GdaDvmlAGgsE~~I~PlslaGF~r~RALSt~nd~P~~aSRPfD~~RdGFVmGEGagv  261 (440)
T KOG1394         182 SVSTACATGNHCIGDAFNFIRLGDADVMLAGGSEACINPLSLAGFSRARALSTRNDNPQKASRPFDKKRDGFVMGEGAGV  261 (440)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHCCCCEEECCCCCEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEECCCEEE
T ss_conf             66766651430588888788707654552267530005222343788777641589931037888667773565066058


Q ss_pred             EEEECCCCCCCCCC--CCCCEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             34402654465434--4541012320355555617754876544433200103202444557777777888898740010
Q gi|254780497|r  165 LILEGVEVKGSSMA--DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI  242 (324)
Q Consensus       165 ~ll~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~  242 (324)
T Consensus       262 lvlEelEHA~~RgA~I~AE~lGygls~D-----a~Hi-----T~P-----~~dG--------~Ga~~am~raL~~Agl~p  318 (440)
T KOG1394         262 LVLEELEHAKKRGAPIYAEVLGYGLSSD-----AYHI-----TSP-----DPDG--------AGAVLAMERALKDAGLSP  318 (440)
T ss_pred             EEHHHHHHHHHCCCCEEHHHHCCCCCCC-----CCCC-----CCC-----CCCC--------CHHHHHHHHHHHHCCCCH
T ss_conf             7618678898749915277645752566-----3434-----789-----9873--------058999999998749995


Q ss_pred             CCCCCCCCCCCCHH
Q ss_conf             00121024444415
Q gi|254780497|r  243 ENIDWFVPHQANWR  256 (324)
Q Consensus       243 ~did~~~~Hq~~~~  256 (324)
T Consensus       319 e~i~YvNAHATST~  332 (440)
T KOG1394         319 EDIDYVNAHATSTP  332 (440)
T ss_pred             HHCCEEECCCCCCC
T ss_conf             65570530333576