HHsearch alignment for GI: 254780497 and conserved domain: PRK05952

>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed.
Probab=99.68  E-value=1.2e-14  Score=113.23  Aligned_cols=288  Identities=22%  Similarity=0.319  Sum_probs=173.8

Q ss_pred             CCEEEEEEEEEECCCCEECHHHHHHHHCCCHHHHHHCCCCCEEE-EE-----------CCCCCHHHHHHHHHHHHHHHHC
Q ss_conf             92269999999649841178899988099987811024751889-82-----------8988999999999999997402
Q gi|254780497|r    1 MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IA-----------GKDETTASLGEAAARDALHHAE   68 (324)
Q Consensus         1 M~~~~I~~~g~ylP~~~v~~~el~~~~~~~~~~i~~~~GI~~R~-~~-----------~~~e~~~~la~~Aa~~al~~a~   68 (324)
T Consensus         1 M~RVVITGiG~vSplG~-~~e~w~~L~-------~G~sgI~~~~~f~~~~~~~~~~~~~~~~~~~~l~~~a~~~Al~dAg   72 (379)
T PRK05952          1 MMKVVVTGIGLVSALGS-LEQSWQRLL-------QGKSGIKLHQPFPELPPLPLGLIGSQPISLEDLTQTTVTAALKDAG   72 (379)
T ss_pred             CCEEEEECCEEECCCCC-HHHHHHHHH-------CCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             98799945110688888-599999997-------6898825677777777614200277856899999999999999779


Q ss_pred             CCCCCCCE-EEEECCCCC----------C----------------CCCC-CCCCHHHHHHCCCCCCCCCCCCCCCHHHHH
Q ss_conf             12354433-665012233----------4----------------5898-531001122026864444210122003467
Q gi|254780497|r   69 MSVDDIDL-IIVATSTPD----------Q----------------TFPS-TAVNIQNRLGMKRGFAFDMQAVCSGFVYAV  120 (324)
Q Consensus        69 ~~~~~Id~-ii~~s~~~~----------~----------------~~p~-~a~~i~~~LGl~~~~~~di~~~C~~~~~al  120 (324)
T Consensus        73 l~~~~~~~gv~~Gt~~g~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~p~~~a~~ia~~~g~~-G~~~~~~~aCaS~~~Ai  151 (379)
T PRK05952         73 LTPPLTDCGVVIGSSRGFQGQWEKLARQIYVGDQSGDEAEENWLDTLPHQAAIATARQIGAQ-GPVLAPMAACATGIWAI  151 (379)
T ss_pred             CCCCCCCEEEEEEECCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC-CCEECCCCHHHHHHHHH
T ss_conf             99975465899996752676899999875204788866721699985339999999983999-96204012747899999


Q ss_pred             HHHHHHHHHCCCCCCEEEEECC-CCCC---------------CCCCC-CCCCCCCCCCCCEEEEECCCCCCCCCCC--CC
Q ss_conf             8889989641556531676302-2432---------------22456-6323234544312344026544654344--54
Q gi|254780497|r  121 TTADSYIRSGVVRRVMVIGSDT-FSRI---------------VDWSD-RSTCVLFGDGAGALILEGVEVKGSSMAD--TG  181 (324)
Q Consensus       121 ~~A~~li~~g~~~~~Lvv~~e~-~S~~---------------~d~~d-~~~~~lfGDGAaA~ll~~~~~~~~~~~~--~~  181 (324)
T Consensus       152 ~~A~~~I~~G~~d~~i~gg~~~~~~~~~~~~f~~~~~ls~~~~rPFd~~r~G~v~gEGa~~lvLE~~~~A~~rga~iya~  231 (379)
T PRK05952        152 AQGAELIQTGQCQRVIAGAVESPITPLTLAGFQKMGALAKTGAYPFDRQREGLVLGEGGAILVLESEELAQKRGAKIYGQ  231 (379)
T ss_pred             HHHHHHHHCCCCCEEEEEEEEEECCHHHHHHHHHCCCCCCCCCCCCCCCCCCEECCCCCEEEEECCHHHHHHCCCCEEEE
T ss_conf             99999998399887986787652482768999865783446767454689960258750467645599998789956899


Q ss_pred             CEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHH----
Q ss_conf             1012320355555617754876544433200103202444557777777888898740010001210244444158----
Q gi|254780497|r  182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRI----  257 (324)
Q Consensus       182 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~~did~~~~Hq~~~~~----  257 (324)
T Consensus       232 i~g~~~~~d~~~~---------------~~~~~~g--------~~~~~am~~al~~agi~~~~Idyi~aHgtgT~~~D~~  288 (379)
T PRK05952        232 ILGFGLTCDAYHM---------------SAPEPSG--------KSAILAIQQCLARSGLTPEDIDYIHAHGTATRLNDQR  288 (379)
T ss_pred             EECCEECCCCCCC---------------CCCCCCH--------HHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCHH
T ss_conf             9352553689888---------------7889898--------9999999999998499833352899467878776999


Q ss_pred             -HHHHHHHCCCCHHHH-HH-HHHHHCCCHHHHHHHHHHH---HHHCCCCC---------------------CCCEEEEEE
Q ss_conf             -999999719787673-36-5865193301269999999---99806889---------------------998999999
Q gi|254780497|r  258 -INSIVDKMKIPFDKV-IV-TVDIHGNTSAASIPLALAV---AVKEGRVK---------------------KGDCLLLEA  310 (324)
Q Consensus       258 -~~~~~~~lgl~~e~~-~~-~~~~~Gn~~sas~~~~L~~---~~~~g~l~---------------------~Gd~vll~~  310 (324)
T Consensus       289 E~~ai~~vfg---~~~~v~s~Ks~~GH~~~aaG~~e~~~~~l~l~~~~ippt~n~~~p~~~l~~v~~~~~~~~~~aL~ns  365 (379)
T PRK05952        289 EANLIQTLFP---HRVAVSSTKGATGHTLGASGALGVAFSLLALRHQQLPPCVGLQEPEFDLNFVRQARQSPLKNVLCLS  365 (379)
T ss_pred             HHHHHHHHHC---CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEE
T ss_conf             9999999718---7788778743324532777999999999999539718988999999899877876337888999962


Q ss_pred             ECCCCCEEEEEEE
Q ss_conf             7145014568786
Q gi|254780497|r  311 MGGGFTSGTVLLR  323 (324)
Q Consensus       311 ~G~G~s~~a~llr  323 (324)
T Consensus       366 fgfGG~Na~lvl~  378 (379)
T PRK05952        366 FGFGGQNAAIALG  378 (379)
T ss_pred             ECCCCEEEEEEEE
T ss_conf             2587368999996