HHsearch alignment for GI: 254780497 and conserved domain: PRK06205

>PRK06205 acetyl-CoA acetyltransferase; Provisional.
Probab=94.56  E-value=0.18  Score=29.22  Aligned_cols=92  Identities=18%  Similarity=0.225  Sum_probs=55.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCH---HHHHHH--HHHHCCCH---HHHHHHHHHHHHHCCC
Q ss_conf             777888898740010001210244444158999999719787---673365--86519330---1269999999998068
Q gi|254780497|r  228 VELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPF---DKVIVT--VDIHGNTS---AASIPLALAVAVKEGR  299 (324)
Q Consensus       228 ~~~i~~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~---e~~~~~--~~~~Gn~~---sas~~~~L~~~~~~g~  299 (324)
T Consensus       301 v~A~~~~L~~agl~~~Did~~EinEAFA~q~la~~~~l~i~~~d~~kvN~~GGaiAlGHP~GaTGarl~~~l~~~L~~--  378 (404)
T PRK06205        301 VPATEKALARAGLTLDDIDLIELNEAFAAQVLAVLKEWGFSDADEERLNVNGSGISLGHPVGATGGRILATLLRELQR--  378 (404)
T ss_pred             HHHHHHHHHHCCCCHHHCCEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHH--
T ss_conf             999999999859983107744631477888999999839898873408988548874888120189999999999997--


Q ss_pred             CCCCCEEEE-EEECCCCCEEEEEEE
Q ss_conf             899989999-997145014568786
Q gi|254780497|r  300 VKKGDCLLL-EAMGGGFTSGTVLLR  323 (324)
Q Consensus       300 l~~Gd~vll-~~~G~G~s~~a~llr  323 (324)
T Consensus       379 -~~~~~Gl~s~C~ggG~g-~A~~iE  401 (404)
T PRK06205        379 -RQGRYGLETMCIGGGQG-LAAVFE  401 (404)
T ss_pred             -HCCCEEEEEECCCCCEE-EEEEEE
T ss_conf             -09998999964210304-389999