HHsearch alignment for GI: 254780497 and conserved domain: PRK07204

>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed.
Probab=100.00  E-value=0  Score=543.56  Aligned_cols=317  Identities=30%  Similarity=0.532  Sum_probs=290.7

Q ss_pred             CC-EEEEEEEEEECCCCEECHHHHHHHHCCCHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             92-26999999964984117889998809998781102475188982898899999999999999740212354433665
Q gi|254780497|r    1 MI-RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIV   79 (324)
Q Consensus         1 M~-~~~I~~~g~ylP~~~v~~~el~~~~~~~~~~i~~~~GI~~R~~~~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~   79 (324)
T Consensus         1 m~~~v~I~g~g~ylP~~~v~n~el~~~~~~~~~~i~~~tGI~~R~~a-~~e~~sdma~~Aa~~aL~~agi~~~dIdliI~   79 (329)
T PRK07204          1 MKRYISIKGIGTYLPKRKVDSLEIDKMLDVPEGWTLKKAGVKTRYFV-DGETSSYMGAEAAKKAVEDAKLTWDDIDCIIC   79 (329)
T ss_pred             CCCCEEEEEEEEECCCCEECHHHHHHHCCCCHHHHHHCCCCEEEEEC-CCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEE
T ss_conf             99854999999966997285999998809987999762386168557-99985999999999999975989888849999


Q ss_pred             ECCCCCCCCCCCCCCHHHHHHCCCC--CCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             0122334589853100112202686--44442101220034678889989641556531676302243222456632323
Q gi|254780497|r   80 ATSTPDQTFPSTAVNIQNRLGMKRG--FAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVL  157 (324)
Q Consensus        80 ~s~~~~~~~p~~a~~i~~~LGl~~~--~~~di~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~S~~~d~~d~~~~~l  157 (324)
T Consensus        80 ~s~t~d~~~P~~A~~v~~~LGl~~~~~~afDi~~aC~g~~~al~~A~~~i~~g~~~~~Lvv~~e~~S~~~d~~~~~~~~l  159 (329)
T PRK07204         80 GSGTIQQAIPSTASLIQEQLGLQHSGIPCFDINSTCLSFITALDTISYAIECGRYKNVVIISSEISSVGLNWGQNESSIL  159 (329)
T ss_pred             ECCCCCCCCCCHHHHHHHHHCCCCCCCEEEEHHHHCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCCCCCE
T ss_conf             25789988980999999996478888355003011448999999999998669865258960334554436444331201


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCEEECCCCC---------CCCCCCCHHHCCHHHHHHHHHHHH
Q ss_conf             45443123440265446543445410123203555556177548765---------444332001032024445577777
Q gi|254780497|r  158 FGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPS---------TSRTVGCIRMEGKAVFKYAVEKAV  228 (324)
Q Consensus       158 fGDGAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------~~~~~~~~~~~g~~~~~~~~~~~~  228 (324)
T Consensus       160 fGDGA~A~vl~~~~~~------~~il~~~~~t~~~~~~~~~~~~gg~~~~~~~~~~~~~~~~~~~~~g~~v~~~~~~~~~  233 (329)
T PRK07204        160 FGDGAAAVVITKGDHS------SSIIASHMETYSSGAHLSEIRGGGTMIHPREYSEERKEDFLFDMNGRAIFKLSSKYLM  233 (329)
T ss_pred             ECCCCEEEEEECCCCC------CCEEEEEEEECCCCHHHHCCCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHH
T ss_conf             1465148999505888------8447799765479704411136985478632333346673176057999999986269


Q ss_pred             HHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             77888898740010001210244444158999999719787673365865193301269999999998068899989999
Q gi|254780497|r  229 ELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLL  308 (324)
Q Consensus       229 ~~i~~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e~~~~~~~~~Gn~~sas~~~~L~~~~~~g~l~~Gd~vll  308 (324)
T Consensus       234 ~~i~~~L~~~gl~~~DId~~i~HQ~n~~~~~~i~~~lgip~ek~~~~~~~~GNt~sasipi~L~~~~~~g~i~~Gd~vll  313 (329)
T PRK07204        234 KFIDKLLMDTGYSLADIDLIVPHQASGPAMRLIRKKLGVDEERFMTIFEDYGNMISASIPVALFEAIKQKKVQRGNKILL  313 (329)
T ss_pred             HHHHHHHHHCCCCHHHCCEEEEECCCHHHHHHHHHHCCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCEEEE
T ss_conf             99999998719997889989981488899999999809697762103631180898889999999998499999699999


Q ss_pred             EEECCCCCEEEEEEEC
Q ss_conf             9971450145687869
Q gi|254780497|r  309 EAMGGGFTSGTVLLRW  324 (324)
Q Consensus       309 ~~~G~G~s~~a~llrw  324 (324)
T Consensus       314 ~~~GaG~s~ga~l~~~  329 (329)
T PRK07204        314 LGTSAGLSIGGILLEY  329 (329)
T ss_pred             EEEEHHHHHHHEEEEC
T ss_conf             9988674150203769