HHsearch alignment for GI: 254780497 and conserved domain: PRK07851

>PRK07851 acetyl-CoA acetyltransferase; Provisional.
Probab=99.57  E-value=8.7e-14  Score=107.75  Aligned_cols=100  Identities=21%  Similarity=0.201  Sum_probs=84.9

Q ss_pred             CCCCCHHHHHHHHHHHHHHHH-CCCCCCCCEEEEECCCCCCCC-CCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             898899999999999999740-212354433665012233458-985310011220268644442101220034678889
Q gi|254780497|r   47 GKDETTASLGEAAARDALHHA-EMSVDDIDLIIVATSTPDQTF-PSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTAD  124 (324)
Q Consensus        47 ~~~e~~~~la~~Aa~~al~~a-~~~~~~Id~ii~~s~~~~~~~-p~~a~~i~~~LGl~~~~~~di~~~C~~~~~al~~A~  124 (324)
T Consensus        22 l~~~~~~~L~a~~i~~~l~r~~~l~p~~Id~Vi~G~~~~~g~~g~n~aR~aaL~aGl~~vpa~TVnr~C~SGl~Ai~~aa  101 (405)
T PRK07851         22 LVDMRPDDLAAQMVRAALDKVPALDPHDIDDLMLGCGLPGGESGFNIARVVAVLLGYDFLPGTTVNRYCSSSLQTTRMAF  101 (405)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCCHHHCCEEEEECCCCCCCCCCCHHHHHHHHCCCCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             89999999999999999986679798998989998377546432309999999739999863457560205799999999


Q ss_pred             HHHHHCCCCCCEEEEECCCCCC
Q ss_conf             9896415565316763022432
Q gi|254780497|r  125 SYIRSGVVRRVMVIGSDTFSRI  146 (324)
Q Consensus       125 ~li~~g~~~~~Lvv~~e~~S~~  146 (324)
T Consensus       102 ~~I~~G~~dvvlAGGvEsMS~~  123 (405)
T PRK07851        102 HAIKAGEGDAFISAGVETVSRF  123 (405)
T ss_pred             HHHHCCCCCEEEEECCCCCCCC
T ss_conf             9997699998999681715567