HHsearch alignment for GI: 254780497 and conserved domain: PRK07855

>PRK07855 lipid-transfer protein; Provisional.
Probab=99.40  E-value=5.2e-11  Score=90.05  Aligned_cols=253  Identities=14%  Similarity=0.142  Sum_probs=141.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHCCCCCCC-CCCCCCCCHHHHHHHHHHH
Q ss_conf             988999999999999997402123544336650122334589853100112202686444-4210122003467888998
Q gi|254780497|r   48 KDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAF-DMQAVCSGFVYAVTTADSY  126 (324)
Q Consensus        48 ~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~~~~~~p~~a~~i~~~LGl~~~~~~-di~~~C~~~~~al~~A~~l  126 (324)
T Consensus        20 ~~~s~~~L~~eA~~~AL~DAGl~~~dIDg~~~~~~~---~~~--~~~ia~~lG~~~~~~~~~v~~~g~s~~~~~~~A~~a   94 (386)
T PRK07855         20 SGRSELRLACEAVLAALDDAGLAPSDVDGLVTFTMD---TNP--EIAVARAVGIGELKFFSQIGYGGGAACATVQQAAMA   94 (386)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEEECC---CCC--HHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             998999999999999999759999996999896078---882--899999719988753221478855799999999999


Q ss_pred             HHHCCCCCCEEEEECCCCC-------------------------------------------CC----------------
Q ss_conf             9641556531676302243-------------------------------------------22----------------
Q gi|254780497|r  127 IRSGVVRRVMVIGSDTFSR-------------------------------------------IV----------------  147 (324)
Q Consensus       127 i~~g~~~~~Lvv~~e~~S~-------------------------------------------~~----------------  147 (324)
T Consensus        95 IasG~~d~vl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~G~~~p~~~~Al~a~rym~~yG~t~E~lA~Vavk  174 (386)
T PRK07855         95 VATGVADVVVAYRAFNERSGMRFGQVQTGLATNPTSEGVDYGWSYPHGLLTPAAWVAMIARRYMHEYGATSEDFGRVAVA  174 (386)
T ss_pred             HHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHH
T ss_conf             97387778999974146763223667555555533233331100234677668899999999999979599999999999


Q ss_pred             -------C----CCCC-CC------------------CCCCCCCCCEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCE
Q ss_conf             -------2----4566-32------------------3234544312344026544654344541012320355555617
Q gi|254780497|r  148 -------D----WSDR-ST------------------CVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKL  197 (324)
Q Consensus       148 -------d----~~d~-~~------------------~~lfGDGAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (324)
T Consensus       175 nr~nA~~NP~A~~~~~~iT~edvl~S~~Ia~PL~lldc~~~sDGAaAvVl~s~e~A~~~~~~pv~i~~~~~g~~--~~~~  252 (386)
T PRK07855        175 DRKHAATNPKAFFYGKPITLEDHQNSRWIAEPLRLLDCCQETDGAVAIVVTSAERARDLKQRPAVIEAAAQGSG--ADQY  252 (386)
T ss_pred             HHHHHHCCCHHHHCCCCCCHHHHHCCCCCCCCCHHHHCCCCCCCEEEEEEECHHHHHHCCCCCEEEEEEEEEEC--CCCC
T ss_conf             99987419598873789889998516671665457553887884389999449999756899779999998713--6765


Q ss_pred             EECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHH----HHH
Q ss_conf             7548765444332001032024445577777778888987400100012102444441589999997197876----733
Q gi|254780497|r  198 YVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFD----KVI  273 (324)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e----~~~  273 (324)
T Consensus       253 ---------~~~~~~~~d---~--~~~~~~~~aa~~ay~~AGi~p~DiDv~e~~D~Ft~~el~~lE~lG~c~~Ge~~~~v  318 (386)
T PRK07855        253 ---------TMTSYYRDD---L--TGLPEMGLVARQLWRQSGLGPADIQTAILYDHFTPFVLMQLEELGFCGRGEAKDFI  318 (386)
T ss_pred             ---------CCCCCCCCC---C--CCCCHHHHHHHHHHHHCCCCHHHCCEEEECCCCCHHHHHHHHHCCCCCCCCHHHHH
T ss_conf             ---------544334564---4--45627999999999984999788726763067709999999984998898379999


Q ss_pred             H------------H----HHHHCCCHHHHHHHHHHHHHHC---CCCCCCCEEEEEEECCCCCEEEEEE
Q ss_conf             6------------5----8651933012699999999980---6889998999999714501456878
Q gi|254780497|r  274 V------------T----VDIHGNTSAASIPLALAVAVKE---GRVKKGDCLLLEAMGGGFTSGTVLL  322 (324)
Q Consensus       274 ~------------~----~~~~Gn~~sas~~~~L~~~~~~---g~l~~Gd~vll~~~G~G~s~~a~ll  322 (324)
T Consensus       319 ~~G~~~~~G~~PvN~sGGlls~gh~~G~~gv~Eav~QLrG~A~~QV-~~a~~alv~~~gG~~~~~~~l  385 (386)
T PRK07855        319 ADGAIEIGGRLPINTHGGQLGEAYIHGMNGIAEAVRQLRGTSVNQV-PGVEHVLVTAGTGVPTSGLIL  385 (386)
T ss_pred             HCCCCCCCCCCCCCCCCCHHCCCCCCCHHHHHHHHHHHHCCCCCCC-CCHHEEEEECCCCHHHHHHCC
T ss_conf             7799557997146589700146764307789999999748641359-940458893898444433015