HHsearch alignment for GI: 254780497 and conserved domain: PRK08242

>PRK08242 acetyl-CoA acetyltransferase; Validated.
Probab=99.53  E-value=9.8e-13  Score=101.05  Aligned_cols=100  Identities=17%  Similarity=0.187  Sum_probs=84.5

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-CCCCCCCCHHHHHHCCC-CCCCCCCCCCCCHHHHHHHHH
Q ss_conf             8988999999999999997402123544336650122334-58985310011220268-644442101220034678889
Q gi|254780497|r   47 GKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQ-TFPSTAVNIQNRLGMKR-GFAFDMQAVCSGFVYAVTTAD  124 (324)
Q Consensus        47 ~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~~~~-~~p~~a~~i~~~LGl~~-~~~~di~~~C~~~~~al~~A~  124 (324)
T Consensus        23 l~~~~~~~L~a~~i~~~l~r~~i~~~~Id~vi~G~v~~~g~~g~n~aR~~al~aGlp~~vpa~TVnr~C~SGl~Ai~~Aa  102 (402)
T PRK08242         23 LHEVKPVRLAAGLLNALRDRNGLDTAAVDDVVLGCVTPVGDQGADIARTAVLAAGLPETVPGVQINRFCASGLEAVNLAA  102 (402)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEEECCCCCCCCCCHHHHHHHHCCCCCCCCEEEECCCCHHHHHHHHHHH
T ss_conf             79898999999999999987098989999799980776554457799999997699988864788450557899999999


Q ss_pred             HHHHHCCCCCCEEEEECCCCCC
Q ss_conf             9896415565316763022432
Q gi|254780497|r  125 SYIRSGVVRRVMVIGSDTFSRI  146 (324)
Q Consensus       125 ~li~~g~~~~~Lvv~~e~~S~~  146 (324)
T Consensus       103 ~~I~~G~~dv~iAGGvEsmS~~  124 (402)
T PRK08242        103 AKVRSGWDDLVIAGGVESMSRV  124 (402)
T ss_pred             HHHHCCCCCEEEECCCCCCCCC
T ss_conf             9996699888997661345657