HHsearch alignment for GI: 254780497 and conserved domain: PRK08242

>PRK08242 acetyl-CoA acetyltransferase; Validated.
Probab=94.20  E-value=0.32  Score=27.58  Aligned_cols=91  Identities=24%  Similarity=0.327  Sum_probs=58.8

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHH--HHHHCCCH---HHHHHHHHHHHHHCCCCCC
Q ss_conf             777888898740010001210244444158999999719787673365--86519330---1269999999998068899
Q gi|254780497|r  228 VELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVT--VDIHGNTS---AASIPLALAVAVKEGRVKK  302 (324)
Q Consensus       228 ~~~i~~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e~~~~~--~~~~Gn~~---sas~~~~L~~~~~~g~l~~  302 (324)
T Consensus       303 v~A~~k~L~~agl~~~did~~EinEAFA~q~la~~~~l~id~~kvN~~GGaiAlGHP~GaSGariv~~l~~~L~~---~~  379 (402)
T PRK08242        303 VPATRKALAKAGLTISDIDLFELNEAFASVVLRFMKALGIPHDKVNVNGGAIAMGHPLGATGAMILGTVLDELER---RG  379 (402)
T ss_pred             HHHHHHHHHHCCCCCCCCCEEEEEHHHHHHHHHHHHHHCCCHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHH---CC
T ss_conf             999999999869984568878860666888999999849988884998667874888035589999999999987---09


Q ss_pred             CCEEEE-EEECCCCCEEEEEE
Q ss_conf             989999-99714501456878
Q gi|254780497|r  303 GDCLLL-EAMGGGFTSGTVLL  322 (324)
Q Consensus       303 Gd~vll-~~~G~G~s~~a~ll  322 (324)
T Consensus       380 ~~~Gl~s~C~ggG~g~-A~~i  399 (402)
T PRK08242        380 KRTALITLCVGGGMGI-ATII  399 (402)
T ss_pred             CCEEEEEECCCCCCEE-EEEE
T ss_conf             9889999733336032-8999