HHsearch alignment for GI: 254780497 and conserved domain: PRK08313

>PRK08313 acetyl-CoA acetyltransferase; Provisional.
Probab=99.54  E-value=2.7e-12  Score=98.23  Aligned_cols=250  Identities=20%  Similarity=0.181  Sum_probs=150.5

Q ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCC--CCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             988999999999999997402123544336650122334589--853100112202686444421012200346788899
Q gi|254780497|r   48 KDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFP--STAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS  125 (324)
Q Consensus        48 ~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~~~~~~p--~~a~~i~~~LGl~~~~~~di~~~C~~~~~al~~A~~  125 (324)
T Consensus        21 ~~~s~~~L~~eA~~~Al~DAGl~~~dID~~~~g~~-~~~~~g~~~~~~~~~~~lG~~~~p~~~v~~~~asg~~a~~~A~~   99 (391)
T PRK08313         21 QDVSMAGLVREAIDRALADAGLTFDDIDAVVVGKA-PDFFEGVMMPELFLADAIGATGKPLIRVHTAGSVGGSTAVVAAS   99 (391)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEECC-CCCCCCCCCHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHHHH
T ss_conf             99799999999999999974999899899999765-76455543557899997078788437882531789999999999


Q ss_pred             HHHHCCCCCCEEEEECCCCCCC------------------------------------------------------C---
Q ss_conf             8964155653167630224322------------------------------------------------------2---
Q gi|254780497|r  126 YIRSGVVRRVMVIGSDTFSRIV------------------------------------------------------D---  148 (324)
Q Consensus       126 li~~g~~~~~Lvv~~e~~S~~~------------------------------------------------------d---  148 (324)
T Consensus       100 aI~sG~~d~vlv~g~ek~~~~~~~~~~~~~~~~~~~~g~~~~~~~Al~a~rym~~yG~t~E~lA~Vav~~r~~A~~NP~A  179 (391)
T PRK08313        100 LVQSGKYRRVLAVAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRAYIRRSGAPTHIGAMVAVKDRLNGAKNPYA  179 (391)
T ss_pred             HHHCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHCCCCC
T ss_conf             99748877899987403577654210147874203244766999999999999986989999999999999876119730


Q ss_pred             -CCCCC--------C-----------CCCCCCCCCEEEEECCCCCCCCCC---CCC-CEEEEEECCCCCCCCEEECCCCC
Q ss_conf             -45663--------2-----------323454431234402654465434---454-10123203555556177548765
Q gi|254780497|r  149 -WSDRS--------T-----------CVLFGDGAGALILEGVEVKGSSMA---DTG-ILSTYLCSDGSYIDKLYVDGGPS  204 (324)
Q Consensus       149 -~~d~~--------~-----------~~lfGDGAaA~ll~~~~~~~~~~~---~~~-~~~~~~~~~~~~~~~~~~~~~~~  204 (324)
T Consensus       180 ~~r~~~lt~edvl~s~~Ia~PL~l~dc~~~sDGAaAvVl~s~e~a~~~~~~~~~~~~i~g~~~~~~~-----~~------  248 (391)
T PRK08313        180 HLHQPDITLEKVMASQMLWDPIRFDETCPSSDGACAVVIGDEEAADARVAEGHPVAWIHGTALRTEP-----LA------  248 (391)
T ss_pred             CCCCCCCCHHHCCCCCEEECCCCHHHCCCCCCCCEEEEEECHHHHHHCCCCCCCEEEEEEEEEECCC-----CC------
T ss_conf             0058999888803686475687503018989864799995399997524578972999999986588-----76------


Q ss_pred             CCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCC--CCCCCCCCCCCCHHHHHHHHHHCCCCHH----HHHH----
Q ss_conf             44433200103202444557777777888898740010--0012102444441589999997197876----7336----
Q gi|254780497|r  205 TSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI--ENIDWFVPHQANWRIINSIVDKMKIPFD----KVIV----  274 (324)
Q Consensus       205 ~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~--~did~~~~Hq~~~~~~~~~~~~lgl~~e----~~~~----  274 (324)
T Consensus       249 -~~~~d~~~----------~~~~~~aa~~a~~~Agi~~P~~DiDvaevyD~Ft~~~l~~lE~lGfc~~Ge~~~~v~~G~~  317 (391)
T PRK08313        249 -FAGRDQVN----------PQAGRDAAAALWKAAGITDPIDEIDVAEIYVPFSWFEPMWLENLGFAPEGEGWKLTEAGET  317 (391)
T ss_pred             -CCCCCCCC----------CHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCHHHHHHHHHHCCCCCCCCHHHHHHCCCC
T ss_conf             -45566455----------0899999999999759999510164788615643899999998399888826999977894


Q ss_pred             -------------HHHHHCCCHHHHHHHHHHHHHHC--C-----CCCCCCEEEEEEECCCCCEEEEEE
Q ss_conf             -------------58651933012699999999980--6-----889998999999714501456878
Q gi|254780497|r  275 -------------TVDIHGNTSAASIPLALAVAVKE--G-----RVKKGDCLLLEAMGGGFTSGTVLL  322 (324)
Q Consensus       275 -------------~~~~~Gn~~sas~~~~L~~~~~~--g-----~l~~Gd~vll~~~G~G~s~~a~ll  322 (324)
T Consensus       318 ~~~G~lPvNtsGGlls-g~p~g-a~G~~~v~Ea~~QLrG~Ag~rQV~~a~~al~~~~GG~~~~~~v~i  383 (391)
T PRK08313        318 AIGGRLPVNPSGGVLS-SNPIG-ASGMIRFAEAALQVMGKAGEHQVPGARKALGHAYGGGSQFFSMWV  383 (391)
T ss_pred             CCCCCCCEECCCCHHC-CCCCC-HHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCCEEEEEEEE
T ss_conf             6799844508972330-89872-679999999999965776566489751899955677121699999