HHsearch alignment for GI: 254780497 and conserved domain: PRK08439

>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed.
Probab=99.54  E-value=1.8e-12  Score=99.33  Aligned_cols=288  Identities=20%  Similarity=0.262  Sum_probs=162.0

Q ss_pred             CCEEEEEEEEEECCCCEECHHHH-HHHHCCCHHHHHHCCCCCE-----------EE---EE--------CCC-----CCH
Q ss_conf             92269999999649841178899-9880999878110247518-----------89---82--------898-----899
Q gi|254780497|r    1 MIRSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISR-----------RH---IA--------GKD-----ETT   52 (324)
Q Consensus         1 M~~~~I~~~g~ylP~~~v~~~el-~~~~~~~~~~i~~~~GI~~-----------R~---~~--------~~~-----e~~   52 (324)
T Consensus         1 MrRVvITGiG~vsp~G~-~~e~~w~~L~~-------G~sgi~~~~~~d~~~~~~~~ag~v~~fd~~~~~~~~~~~~~dr~   72 (405)
T PRK08439          1 MKRVVVTGMGMINSLGL-DKESSFKAICN-------GECGIKKITLFDASDFPVKIAGEITDFDPTEVMDPKEVKKADRF   72 (405)
T ss_pred             CCCEEEECCEEECCCCC-CHHHHHHHHHC-------CCCCEEECCCCCCCCCCCEEEEEECCCCHHHCCCHHHHHHHCHH
T ss_conf             97199973134798718-99999999983-------99977748876766897418998388795673899999862899


Q ss_pred             HHHHHHHHHHHHHHHCCCC----CCCCEEEEECCCCC-----------------CCCC----C-----CCCCHHHHHHCC
Q ss_conf             9999999999997402123----54433665012233-----------------4589----8-----531001122026
Q gi|254780497|r   53 ASLGEAAARDALHHAEMSV----DDIDLIIVATSTPD-----------------QTFP----S-----TAVNIQNRLGMK  102 (324)
Q Consensus        53 ~~la~~Aa~~al~~a~~~~----~~Id~ii~~s~~~~-----------------~~~p----~-----~a~~i~~~LGl~  102 (324)
T Consensus        73 ~~lal~aa~eAl~dAGl~~~~~~~r~Gv-~~gt~~g~~~~~~~~~~~~~~~g~~~~~p~~~~~~~~~~~a~~is~~~~~~  151 (405)
T PRK08439         73 IQLGLKAAREAMKDAGFLEEHDKDRFGV-SSASGIGGLPNIEKNSIICFEKGPRKISPFFIPSALVNMLGGFISIEHGLK  151 (405)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCEEE-EEEECCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             9999999999998448775577566799-998667755779999999984697644802767888889999999983998


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCC-CC----------C-----------CCCCCC-CCCCCCC
Q ss_conf             86444421012200346788899896415565316763022-43----------2-----------224566-3232345
Q gi|254780497|r  103 RGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTF-SR----------I-----------VDWSDR-STCVLFG  159 (324)
Q Consensus       103 ~~~~~di~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~-S~----------~-----------~d~~d~-~~~~lfG  159 (324)
T Consensus       152 -Gp~~tv~tACass~~Ai~~A~~~I~~G~~d~~ivgG~~~~l~~~~~~~f~~~~~ls~~~~~P~~~~rPFD~~r~G~v~g  230 (405)
T PRK08439        152 -GPNLSSVTACAAGTHAIIEAVKTIMLGGADKMLVVGAESAICPVGIGGFASMKALSTRNDDPKKASRPFDKDRDGFVMG  230 (405)
T ss_pred             -CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             -9765626375899999999999997089776774150220273568999875323025889654667876899847742


Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             44312344026544654344541012320355555617754876544433200103202444557777777888898740
Q gi|254780497|r  160 DGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH  239 (324)
Q Consensus       160 DGAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~g  239 (324)
T Consensus       231 EGa~~lvLe~~~~A~~rg--a~i~a~i~G-~~~~~d-----~-------~~~t~P~--------~~g~~~a~~~Al~~ag  287 (405)
T PRK08439        231 EGAGALVLEEYESAKKRG--AKIYAELIG-FGESGD-----A-------NHITSPA--------PDGPLRAMKKALEMAG  287 (405)
T ss_pred             CCEEEEEECCHHHHHHCC--CEEEEEEEE-ECCCCC-----C-------CCCCCCC--------HHHHHHHHHHHHHHCC
T ss_conf             467889724488786579--968999998-767668-----8-------8998989--------8999999999999759


Q ss_pred             CCCCCCCCCCCCCCCHH-----HHHHHHHHCCCCHHH--HHHHHHHHCCCHHHHHHHHHH---HHHHCCCCCC-------
Q ss_conf             01000121024444415-----899999971978767--336586519330126999999---9998068899-------
Q gi|254780497|r  240 LTIENIDWFVPHQANWR-----IINSIVDKMKIPFDK--VIVTVDIHGNTSAASIPLALA---VAVKEGRVKK-------  302 (324)
Q Consensus       240 l~~~did~~~~Hq~~~~-----~~~~~~~~lgl~~e~--~~~~~~~~Gn~~sas~~~~L~---~~~~~g~l~~-------  302 (324)
T Consensus       288 ~~--~idyi~aHgTgT~~gD~~E~~Ai~~vfg~~~~~~~v~S~Ks~iGH~~gAaG~~e~i~~~lal~~g~ippt~n~~~~  365 (405)
T PRK08439        288 NP--KVDYVNAHGTSTPYNDKNETAALKELFGSKENVPPVSSTKGQIGHCLGAAGAIEAVISIMAMRDGILPPTINQETP  365 (405)
T ss_pred             CC--CEEEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCHHHHCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99--6117972057687878999999999856667788865731000323666789999999999964955898999999


Q ss_pred             -----------------CCEEEEEEECCCCCEEEEEEE
Q ss_conf             -----------------989999997145014568786
Q gi|254780497|r  303 -----------------GDCLLLEAMGGGFTSGTVLLR  323 (324)
Q Consensus       303 -----------------Gd~vll~~~G~G~s~~a~llr  323 (324)
T Consensus       366 dp~~~l~~v~~~~~~~~~~~al~nSFGFGG~Na~lvl~  403 (405)
T PRK08439        366 DPECDLDYIPNIARKADLKAVMSNSFGFGGTNGVVIFK  403 (405)
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEE
T ss_conf             98898212789765688789999660477267899998