HHsearch alignment for GI: 254780497 and conserved domain: PRK08768

>PRK08768 consensus.
Probab=99.64  E-value=3.9e-14  Score=109.96  Aligned_cols=298  Identities=20%  Similarity=0.240  Sum_probs=166.5

Q ss_pred             CC-EEEEEEEEEECCCCEECHHHH-HHHH-CCCHH-HHHH--CCCCCEE-----------EEECCC-----CCHHHHHHH
Q ss_conf             92-269999999649841178899-9880-99987-8110--2475188-----------982898-----899999999
Q gi|254780497|r    1 MI-RSTVRGIGLSLPRRVLSNSDL-ESIV-DTSDG-WIKR--RVGISRR-----------HIAGKD-----ETTASLGEA   58 (324)
Q Consensus         1 M~-~~~I~~~g~ylP~~~v~~~el-~~~~-~~~~~-~i~~--~~GI~~R-----------~~~~~~-----e~~~~la~~   58 (324)
T Consensus         1 M~rrVvITGmG~vtp~G~-~~~~~w~~L~~G~s~i~~~~~~d~~~~~~~~~g~i~~fd~~~~~~~~~~~~~d~~~~~~l~   79 (411)
T PRK08768          1 MSRRVVVTGMGMVSPLGN-DLATSWDGIVHGRSGIGPITQIDASQFTTKIAGEIKNFDPTLFVSAKDVKKMDSFIHYGVG   79 (411)
T ss_pred             CCCCEEEECCEEECCCCC-CHHHHHHHHHCCCCCEECCCCCCCCCCCCCEEEECCCCCHHHCCCHHHHHHCCHHHHHHHH
T ss_conf             989899987677897969-9999999998089855407756631487776554588792554899999756999999999


Q ss_pred             HHHHHHHHHCCCCCCCCE----EEEECCCCC-----------------CCCC---------CCCCCHHHHHHCCCCCCCC
Q ss_conf             999999740212354433----665012233-----------------4589---------8531001122026864444
Q gi|254780497|r   59 AARDALHHAEMSVDDIDL----IIVATSTPD-----------------QTFP---------STAVNIQNRLGMKRGFAFD  108 (324)
Q Consensus        59 Aa~~al~~a~~~~~~Id~----ii~~s~~~~-----------------~~~p---------~~a~~i~~~LGl~~~~~~d  108 (324)
T Consensus        80 aa~~Al~dAGl~~~~~~~~r~Gv~vGt~~g~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~a~~is~~~g~~-Gp~~t  158 (411)
T PRK08768         80 ASFMALDDSGLEINESNAERVGAILGSGIGGLLGIEEQTIKFHEGGARKISPFYVPSTIINMLPGQVSLIKGLK-GPTFS  158 (411)
T ss_pred             HHHHHHHHHCCCHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHCCC-CCCCC
T ss_conf             99999774189900147655279992266653027899999985685546822556667668999999981998-97625


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCC-C---------------------CCCCC-CCCCCCCCCCCCEE
Q ss_conf             2101220034678889989641556531676302243-2---------------------22456-63232345443123
Q gi|254780497|r  109 MQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSR-I---------------------VDWSD-RSTCVLFGDGAGAL  165 (324)
Q Consensus       109 i~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~S~-~---------------------~d~~d-~~~~~lfGDGAaA~  165 (324)
T Consensus       159 v~taCaS~l~Al~~A~~~i~~G~~d~~ivgg~~~~~~p~~~~~f~~l~~ls~~~~~P~~~~rPFd~~rdG~v~gEGa~~~  238 (411)
T PRK08768        159 AVSACATSNHSIGTAMRMIQHGDADVMLAGGAERGSSPSSVGGFCAMKAMSTRNDDPTGASRPWDKQRDGFVLGDGAGVL  238 (411)
T ss_pred             CCCCCCHHHHHHHHHHHHHHCCCCCEEECCCCHHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCEEEEE
T ss_conf             35411378899999999986788674552642021587889999986545203789887666665799986866804899


Q ss_pred             EEECCCCCCCCCC--CCCCEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             4402654465434--45410123203555556177548765444332001032024445577777778888987400100
Q gi|254780497|r  166 ILEGVEVKGSSMA--DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE  243 (324)
Q Consensus       166 ll~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~~  243 (324)
T Consensus       239 vLe~~e~A~~rga~i~a~i~g~~~~~d~~~----------~~-----~p~~~~--------~~~~~~~~~al~~a~~~~~  295 (411)
T PRK08768        239 VLEEYEHAKARGARIYAELVGFGASSDAFH----------MT-----APSEDG--------EGAARSMAAAMRDAKLNPE  295 (411)
T ss_pred             EECCHHHHHHCCCCEEEEEEEEEECCCCCC----------CC-----CCCCCH--------HHHHHHHHHHHHHCCCCCC
T ss_conf             971488898679907899977876147888----------87-----889777--------9999999999997698931


Q ss_pred             CCCCCCCCCCCHHH-----HHHHHHHCCCCHHHH-H-HHHHHHCCCHHHHHHHHHHH---HHHCCCCCC-----------
Q ss_conf             01210244444158-----999999719787673-3-65865193301269999999---998068899-----------
Q gi|254780497|r  244 NIDWFVPHQANWRI-----INSIVDKMKIPFDKV-I-VTVDIHGNTSAASIPLALAV---AVKEGRVKK-----------  302 (324)
Q Consensus       244 did~~~~Hq~~~~~-----~~~~~~~lgl~~e~~-~-~~~~~~Gn~~sas~~~~L~~---~~~~g~l~~-----------  302 (324)
T Consensus       296 ~i~yi~aHgtgT~~~D~~E~~ai~~~fg~~~~~~~i~s~Ks~~GH~~~aaG~~~~~~~~l~l~~~~ippt~n~~~p~~~~  375 (411)
T PRK08768        296 QIGYLNAHGTSTPLGDLAETMAMKRALGDHAYKTMVSSTKSMTGHLLGAAGGVEAIFSVMALHTGIIPPTINLEEPSEGC  375 (411)
T ss_pred             CEEEEEEECCCCCCCCHHHHHHHHHHHCCCCCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             02489967566755399999999998567899874789445543208999999999999997169739999999999889


Q ss_pred             -------------CCEEEEEEECCCCCEEEEEEE
Q ss_conf             -------------989999997145014568786
Q gi|254780497|r  303 -------------GDCLLLEAMGGGFTSGTVLLR  323 (324)
Q Consensus       303 -------------Gd~vll~~~G~G~s~~a~llr  323 (324)
T Consensus       376 ~l~~v~~~~~~~~~~~al~nsfGfGG~Na~lvl~  409 (411)
T PRK08768        376 DLDYVPNVAREVQVDAVMSNGFGFGGTNGTLVFK  409 (411)
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEE
T ss_conf             8544899766687788999671177010899998