HHsearch alignment for GI: 254780497 and conserved domain: TIGR00747

>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; InterPro: IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH), in general, initiates elongation in type II fatty acid synthase systems found in bacteria and plants. It is responsible for producing the multitude of fatty acid structures found in bacterial membranes . The two members of this subfamily from Bacillus subtilis differ from each other, and from FabH from Escherichia coli, in acyl group specificity. Active site residues include Cys112, His244 and Asn274 of Escherichia coli FabH. Cys-112 is the site of acyl group attachment. ; GO: 0004315 3-oxoacyl-[acyl-carrier-protein] synthase activity, 0006633 fatty acid biosynthetic process.
Probab=100.00  E-value=0  Score=619.96  Aligned_cols=319  Identities=48%  Similarity=0.801  Sum_probs=306.4

Q ss_pred             CEEEEEEEEEECCCCEECHHHHHHHHCCCHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             22699999996498411788999880999878110247518898289889999999999999974021235443366501
Q gi|254780497|r    2 IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVAT   81 (324)
Q Consensus         2 ~~~~I~~~g~ylP~~~v~~~el~~~~~~~~~~i~~~~GI~~R~~~~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s   81 (324)
T Consensus         1 ~~~~i~g~G~YlP~~v~tNadL~k~vDTSDEWI~TRTGI~eRRiAad~E~~S~mg~~AA~~Aie~A~i~~~dID~iivaT   80 (329)
T TIGR00747         1 MKAKILGTGSYLPEKVLTNADLEKMVDTSDEWIVTRTGIKERRIAADDETSSHMGFEAAKKAIENAGISKDDIDLIIVAT   80 (329)
T ss_pred             CEEEEEEEECCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCHHHCCEEEEEC
T ss_conf             93578986030775135733345321068331123686100021472012689999999999985278866878679805


Q ss_pred             CCCCC-CCCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCCC
Q ss_conf             22334-58985310011220268644442101220034678889989641556531676302243222456632323454
Q gi|254780497|r   82 STPDQ-TFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGD  160 (324)
Q Consensus        82 ~~~~~-~~p~~a~~i~~~LGl~~~~~~di~~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~S~~~d~~d~~~~~lfGD  160 (324)
T Consensus        81 ~~pd~l~fPS~Ac~~~~~LGi~~~~aFD~~AACaGF~Y~Ls~A~~~i~SG~y~~vLvvGaeklSs~~D~~DR~TcvLFGD  160 (329)
T TIGR00747        81 TTPDYLAFPSAACMVQAYLGIKNIPAFDLSAACAGFIYGLSVAKQYIESGKYKTVLVVGAEKLSSTLDWTDRGTCVLFGD  160 (329)
T ss_pred             CCCCCCCCCCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCCCCCCEEEECC
T ss_conf             78000037785899997618667632223656766899999999986157702688998511055367466875799606


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCEEECCCCCC--------CCCCCCHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             431234402654465434454101232035555561775487654--------443320010320244455777777788
Q gi|254780497|r  161 GAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPST--------SRTVGCIRMEGKAVFKYAVEKAVELIE  232 (324)
Q Consensus       161 GAaA~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~g~~~~~~~~~~~~~~i~  232 (324)
T Consensus       161 GAgA~v~g~s~~~~~----~eI~~~~l~AdG~~~~~L~l~~~~~~~P~~~~~~~~~~~f~~M~G~evFk~Av~~m~~~~~  236 (329)
T TIGR00747       161 GAGAVVVGESEDDGG----LEIISTNLGADGTQGELLYLPAGGRRCPFSKNTLQGSSPFITMEGNEVFKHAVRKMLKVVE  236 (329)
T ss_pred             CCEEEEEECCCCCCC----CEEEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             722688704578776----3012346530564432132067776688777734466661787373258899999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHH-HCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEE
Q ss_conf             8898740010001210244444158999999719787673365865-193301269999999998068899989999997
Q gi|254780497|r  233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDI-HGNTSAASIPLALAVAVKEGRVKKGDCLLLEAM  311 (324)
Q Consensus       233 ~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e~~~~~~~~-~Gn~~sas~~~~L~~~~~~g~l~~Gd~vll~~~  311 (324)
T Consensus       237 ~~l~~a~l~~~DiD~lvPHQAN~RIi~a~ak~L~~~~~~Vv~Tv~khyGNTSAASiP~AL~E~~~~G~iK~Gd~~LL~AF  316 (329)
T TIGR00747       237 ETLEAAGLSKEDIDWLVPHQANIRIIEALAKRLELKESKVVKTVHKHYGNTSAASIPIALDELLETGRIKKGDLLLLVAF  316 (329)
T ss_pred             HHHHHHCCCHHHCCEECCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEEE
T ss_conf             99997187830461555541116899999997089803168632001346304346678999874177772448887630


Q ss_pred             CCCCCEEEEEEEC
Q ss_conf             1450145687869
Q gi|254780497|r  312 GGGFTSGTVLLRW  324 (324)
Q Consensus       312 G~G~s~~a~llrw  324 (324)
T Consensus       317 GGGLtWGa~~vr~  329 (329)
T TIGR00747       317 GGGLTWGAALVRF  329 (329)
T ss_pred             CHHHHHHHHHHCC
T ss_conf             6035667775259