HHsearch alignment for GI: 254780497 and conserved domain: cd00832

>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria. CLFs have been shown to have decarboxylase activity towards malonyl-acyl carrier protein (ACP). CLFs are similar to other elongation ketosynthase domains, but their active site cysteine is replaced by a conserved glutamine.
Probab=99.50  E-value=1.4e-12  Score=100.13  Aligned_cols=267  Identities=22%  Similarity=0.223  Sum_probs=149.9

Q ss_pred             CEEEEEEEEEECCCCEECHHHH-HHHHCCCHHH--HHH--CCCCCEE-----------EEECC-----CCCHHHHHHHHH
Q ss_conf             2269999999649841178899-9880999878--110--2475188-----------98289-----889999999999
Q gi|254780497|r    2 IRSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGW--IKR--RVGISRR-----------HIAGK-----DETTASLGEAAA   60 (324)
Q Consensus         2 ~~~~I~~~g~ylP~~~v~~~el-~~~~~~~~~~--i~~--~~GI~~R-----------~~~~~-----~e~~~~la~~Aa   60 (324)
T Consensus         1 rRVvItG~g~~~P~g~-~~~~~w~~L~~G~s~i~~~~~~~~~~~~~~~~g~v~~f~~~~~~~~~~~~~~d~~~~~~l~aa   79 (399)
T cd00832           1 RRAVVTGIGVVAPNGL-GVEEYWKAVLDGRSGLGPITRFDPSGYPARLAGEVPDFDAAEHLPGRLLPQTDRMTRLALAAA   79 (399)
T ss_pred             CCEEEECCEEECCCCC-CHHHHHHHHHCCCCEEECCCCCCCCCCCCCEEEECCCCCHHHCCCHHHHHHCCHHHHHHHHHH
T ss_conf             9299971677897959-999999999729983542775575568776456779878011689889874699999999999


Q ss_pred             HHHHHHHCCCCCCCCE----EEEECCCCCC-----------------CCCC---------CCCCHHHHHHCCCCCCCCCC
Q ss_conf             9999740212354433----6650122334-----------------5898---------53100112202686444421
Q gi|254780497|r   61 RDALHHAEMSVDDIDL----IIVATSTPDQ-----------------TFPS---------TAVNIQNRLGMKRGFAFDMQ  110 (324)
Q Consensus        61 ~~al~~a~~~~~~Id~----ii~~s~~~~~-----------------~~p~---------~a~~i~~~LGl~~~~~~di~  110 (324)
T Consensus        80 ~~Al~dAGl~~~~~~~~~~gv~~g~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~~gl~-Gp~~tv~  158 (399)
T cd00832          80 DWALADAGVDPAALPPYDMGVVTASAAGGFEFGQRELQKLWSKGPRHVSAYQSFAWFYAVNTGQISIRHGMR-GPSGVVV  158 (399)
T ss_pred             HHHHHHCCCCHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC-CCCCCHH
T ss_conf             998886099845648774289994256760255899999974185425611213566778888999982898-8741021


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC---------------C------CCCCCCC-CCCCCCCCCCCEEEEE
Q ss_conf             0122003467888998964155653167630224---------------3------2224566-3232345443123440
Q gi|254780497|r  111 AVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFS---------------R------IVDWSDR-STCVLFGDGAGALILE  168 (324)
Q Consensus       111 ~~C~~~~~al~~A~~li~~g~~~~~Lvv~~e~~S---------------~------~~d~~d~-~~~~lfGDGAaA~ll~  168 (324)
T Consensus       159 tacsssl~Ai~~A~~~i~~G-~d~~i~Gg~~~~l~p~~~~~~~~~g~ls~~~~p~~~~rPFD~~r~G~v~GEGa~~lvLe  237 (399)
T cd00832         159 AEQAGGLDALAQARRLVRRG-TPLVVSGGVDSALCPWGWVAQLSSGRLSTSDDPARAYLPFDAAAAGYVPGEGGAILVLE  237 (399)
T ss_pred             CCCCHHHHHHHHHHHHHHCC-CCHHHCCCCCEEECCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEECCCEEEEEEC
T ss_conf             14707999999999998769-72012177404516288999987566456999986504776789806642766788845


Q ss_pred             CCCCCCCCCCC--CCCEEEEEECCCCCCCCEEECCCCCCCCCCCCHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             26544654344--5410123203555556177548765444332001032024445577777778888987400100012
Q gi|254780497|r  169 GVEVKGSSMAD--TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID  246 (324)
Q Consensus       169 ~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~i~~~L~~~gl~~~did  246 (324)
T Consensus       238 ~~~~A~~rGa~i~a~i~G~~~~~d~----------~~-~~-------~~--------~~~~~~a~~~Al~~agi~p~~I~  291 (399)
T cd00832         238 DAAAARERGARVYGEIAGYAATFDP----------PP-GS-------GR--------PPGLARAIRLALADAGLTPEDVD  291 (399)
T ss_pred             CHHHHHHCCCEEEEEEEEEEECCCC----------CC-CC-------CC--------HHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             4988987889599999888984899----------89-99-------89--------79999999999997199967056


Q ss_pred             CCCCCCCCHH-----HHHHHHHHCCCCHHHH--HHHHHHHCCCHHHHHHHHHHH---HHHCCC
Q ss_conf             1024444415-----8999999719787673--365865193301269999999---998068
Q gi|254780497|r  247 WFVPHQANWR-----IINSIVDKMKIPFDKV--IVTVDIHGNTSAASIPLALAV---AVKEGR  299 (324)
Q Consensus       247 ~~~~Hq~~~~-----~~~~~~~~lgl~~e~~--~~~~~~~Gn~~sas~~~~L~~---~~~~g~  299 (324)
T Consensus       292 yI~aHgTGT~~gD~~E~~Ai~~~fg~--~~~pv~S~K~~iGH~~~AaG~~~~i~~ll~l~~g~  352 (399)
T cd00832         292 VVFADAAGVPELDRAEAAALAAVFGP--RGVPVTAPKTMTGRLYAGGAPLDVATALLALRDGV  352 (399)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHHCC--CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99983375855699999999999669--99878995422110699999999999999983596