HHsearch alignment for GI: 254780497 and conserved domain: pfam00108

>pfam00108 Thiolase_N Thiolase, N-terminal domain. Thiolase is reported to be structurally related to beta-ketoacyl synthase (pfam00109), and also chalcone synthase.
Probab=99.06  E-value=3.9e-10  Score=84.48  Aligned_cols=100  Identities=25%  Similarity=0.285  Sum_probs=86.8

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHCC-CCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             89889999999999999974021235443366501223345898531001122026-86444421012200346788899
Q gi|254780497|r   47 GKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSGFVYAVTTADS  125 (324)
Q Consensus        47 ~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~~~~~~p~~a~~i~~~LGl~-~~~~~di~~~C~~~~~al~~A~~  125 (324)
T Consensus        21 l~~~~~~~L~~~~~~~~l~r~~~~p~~Id~vi~G~~~~~g~~~n~aR~~~l~aGlp~~vp~~tvnr~C~Sgl~Ai~~Aa~  100 (264)
T pfam00108        21 LKDLSAVDLGAIAIKAALERAGVKPEDVDEVIMGNVLQAGEGQNPARQAALKAGIPDSVPAVTINKVCGSGLKAVALAAQ  100 (264)
T ss_pred             CCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEEEECHHHHHHHHHHHHHH
T ss_conf             78898899999999999998599968835688843665677662999999976999888668982320179999999999


Q ss_pred             HHHHCCCCCCEEEEECCCCCC
Q ss_conf             896415565316763022432
Q gi|254780497|r  126 YIRSGVVRRVMVIGSDTFSRI  146 (324)
Q Consensus       126 li~~g~~~~~Lvv~~e~~S~~  146 (324)
T Consensus       101 ~I~~G~~dv~iagGvEsmS~~  121 (264)
T pfam00108       101 AIRAGDADIVVAGGVESMSNA  121 (264)
T ss_pred             HHHCCCCCEEEEECCCCCCCC
T ss_conf             983798766787221356545