HHsearch alignment for GI: 254780497 and conserved domain: pfam00195

>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain. The C-terminal domain of Chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in this N-terminal domain.
Probab=99.95  E-value=2.1e-27  Score=194.60  Aligned_cols=168  Identities=20%  Similarity=0.274  Sum_probs=137.4

Q ss_pred             EEEEEEEEEECCCCEECHHHHHHHH----CC---CH-----HHHHHCCCCCEEEEECCCC--------------------
Q ss_conf             2699999996498411788999880----99---98-----7811024751889828988--------------------
Q gi|254780497|r    3 RSTVRGIGLSLPRRVLSNSDLESIV----DT---SD-----GWIKRRVGISRRHIAGKDE--------------------   50 (324)
Q Consensus         3 ~~~I~~~g~ylP~~~v~~~el~~~~----~~---~~-----~~i~~~~GI~~R~~~~~~e--------------------   50 (324)
T Consensus        16 pA~Il~IgTA~Pp~~~~Q~~~~d~~~~~~~~~~~~~~k~~l~ri~~~sgI~~R~~vl~~e~~~~~P~~~~~~~ps~~~R~   95 (228)
T pfam00195        16 PATILAIGTATPSNCVDQSTYPDYYFRVTKSEHLTDLKEKFQRICEKSTIKKRYMVLTEEILKENPELCTEMAPSLDARQ   95 (228)
T ss_pred             CEEEEEEEEECCCCEECHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEEEECHHHHHHCCCCCCCCCCCHHHHH
T ss_conf             96999999718995524899999999973443242678999989984698831586176876149551025699989999


Q ss_pred             -----CHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCHHHHHHCCCCC-CCCCC-CCCCCHHHHHHHH
Q ss_conf             -----9999999999999974021235443366501223345898531001122026864-44421-0122003467888
Q gi|254780497|r   51 -----TTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQ-AVCSGFVYAVTTA  123 (324)
Q Consensus        51 -----~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~~~~~~~p~~a~~i~~~LGl~~~~-~~di~-~~C~~~~~al~~A  123 (324)
T Consensus        96 ~~~~~~a~~La~~Aa~~AL~~aG~~~~dIthlv~vt~TG-~~~Pg~d~~l~~~LGL~~~v~R~~i~~~GC~gg~~gL~~A  174 (228)
T pfam00195        96 DIAVVEVPKLGKEAALKAIKEWGQPKSKITHLVFCTTSG-VDMPGADYQLTKLLGLRPSVKRVMLYQQGCFAGGTVLRLA  174 (228)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCHHHCCEEEEECCCC-CCCCCHHHHHHHHCCCCCCCHHEEEECCCCHHHHHHHHHH
T ss_conf             999999999999999999999588988999999994799-9887478999998298987211141145416489999999


Q ss_pred             HHHHHHCCCCCCEEEEECCCCCCCCC---CC---CCCCCCCCCCCCEEEEECCC
Q ss_conf             99896415565316763022432224---56---63232345443123440265
Q gi|254780497|r  124 DSYIRSGVVRRVMVIGSDTFSRIVDW---SD---RSTCVLFGDGAGALILEGVE  171 (324)
Q Consensus       124 ~~li~~g~~~~~Lvv~~e~~S~~~d~---~d---~~~~~lfGDGAaA~ll~~~~  171 (324)
T Consensus       175 ~~~~~~~p~~~VLvv~~Elcsl~f~~~~~~~~~~lV~~aLFgDGAaAvvv~adP  228 (228)
T pfam00195       175 KDLAENNKGARVLVVCSEITAVTFRGPSETHLDSLVGQALFGDGAAAVIIGSDP  228 (228)
T ss_pred             HHHHHHCCCCEEEEEEEEHHHEEECCCCCCCHHHHHHHHHCCCCCEEEEEECCC
T ss_conf             999982999879999824011030488765677773441202751799971699