HHsearch alignment for GI: 254780497 and conserved domain: pfam01154

>pfam01154 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthase N terminal.
Probab=99.92  E-value=4.5e-24  Score=173.40  Aligned_cols=165  Identities=18%  Similarity=0.173  Sum_probs=147.0

Q ss_pred             EEEEEEEEEECCCCEECHHHHHHHHCCCHHHHHHCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECC
Q ss_conf             26999999964984117889998809998781102475188982898899999999999999740212354433665012
Q gi|254780497|r    3 RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATS   82 (324)
Q Consensus         3 ~~~I~~~g~ylP~~~v~~~el~~~~~~~~~~i~~~~GI~~R~~~~~~e~~~~la~~Aa~~al~~a~~~~~~Id~ii~~s~   82 (324)
T Consensus         1 ~VGI~~i~~Y~P~~~v~~~~La~~rg~d~~K~~~GlG~~~mav~~~~ED~vTmAanAa~~ll~~~~i~~~~Ig~l~vgTE   80 (171)
T pfam01154         1 DVGIVALEIYFPSQYVDQAELEKYDGVSAGKYTIGLGQTKMGFCTDREDINSLCLTVVQKLMERNNLDYDCIGRLEVGTE   80 (171)
T ss_pred             CCCEEEEEEECCHHEECHHHHHHHHCCCHHHHHHCCCCCEECCCCCCCCHHHHHHHHHHHHHHHCCCCHHHCCEEEECCC
T ss_conf             98987898847711135999999959898885204586354279997279999999999999873999888407996377


Q ss_pred             CCCCCCCCCCCCHHHHHHCC-CC--CCCCCCCCCCCHHHHHHHHHHHHHHCC--CCCCEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             23345898531001122026-86--444421012200346788899896415--56531676302243222456632323
Q gi|254780497|r   83 TPDQTFPSTAVNIQNRLGMK-RG--FAFDMQAVCSGFVYAVTTADSYIRSGV--VRRVMVIGSDTFSRIVDWSDRSTCVL  157 (324)
Q Consensus        83 ~~~~~~p~~a~~i~~~LGl~-~~--~~~di~~~C~~~~~al~~A~~li~~g~--~~~~Lvv~~e~~S~~~d~~d~~~~~l  157 (324)
T Consensus        81 S~iD~SKs~~t~l~~ll~~~~~~~~~~~e~k~ACyggTaAL~~a~~~v~s~~~~~k~alVV~sDiA-~y-~~~~--~e~T  156 (171)
T pfam01154        81 TIIDKSKSVKTVLMQLFEESGNTDIEGIDTTNACYGGTAALFNALNWIESSSWDGRYALVVAGDIA-IY-AKGN--ARPT  156 (171)
T ss_pred             CCCCCCCCHHHHHHHHHCCCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCC-CC-CCCC--CCCC
T ss_conf             645665568999999837657887403330010698999999999999828878963999984100-13-7999--8756


Q ss_pred             CCCCCCEEEEECCC
Q ss_conf             45443123440265
Q gi|254780497|r  158 FGDGAGALILEGVE  171 (324)
Q Consensus       158 fGDGAaA~ll~~~~  171 (324)
T Consensus       157 qGAGAVAmLv~~na  170 (171)
T pfam01154       157 GGAGAVAMLIGPNA  170 (171)
T ss_pred             CCCCEEEEEECCCC
T ss_conf             77035899975899