HHsearch alignment for GI: 254780497 and conserved domain: pfam02797

>pfam02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain. This domain of chalcone synthase is reported to be structurally similar to domains in thiolase and beta-ketoacyl synthase. The differences in activity are accounted for by differences in the N-terminal domain.
Probab=99.65  E-value=5.1e-16  Score=121.97  Aligned_cols=107  Identities=22%  Similarity=0.297  Sum_probs=92.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHH---HHHHHHHCCCHHHHHHHHHHH
Q ss_conf             02444557777777888898740010001210244444158999999719787673---365865193301269999999
Q gi|254780497|r  217 KAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKV---IVTVDIHGNTSAASIPLALAV  293 (324)
Q Consensus       217 ~~~~~~~~~~~~~~i~~~L~~~gl~~~did~~~~Hq~~~~~~~~~~~~lgl~~e~~---~~~~~~~Gn~~sas~~~~L~~  293 (324)
T Consensus        32 ~~VP~~i~~~l~~~v~~~L~~~gl~~~d~~~wa~HPGG~~Ilda~~~~L~L~~~~l~~Sr~vL~~~GNmSS~tVlfVLe~  111 (151)
T pfam02797        32 KDVPQLISKNIEKCLVEAFDPLGISDWNSIFWIAHPGGPAILDQVEAKLGLKPEKLRASRHVLSEYGNMSSACVLFILDE  111 (151)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHH
T ss_conf             26369999989999999998749983324527887997899999999819998999999999997586189999999999


Q ss_pred             HHHCC----CCCCC---CEEEEEEECCCCCEEEEEEE
Q ss_conf             99806----88999---89999997145014568786
Q gi|254780497|r  294 AVKEG----RVKKG---DCLLLEAMGGGFTSGTVLLR  323 (324)
Q Consensus       294 ~~~~g----~l~~G---d~vll~~~G~G~s~~a~llr  323 (324)
T Consensus       112 ~~~~~~~~~~~~~g~~~e~gl~~AfGPG~t~E~~LLR  148 (151)
T pfam02797       112 MRKKSLKKGKSTTGEGLEWGVLFGFGPGLTVETVVLR  148 (151)
T ss_pred             HHHHHHHCCCCCCCCCCCEEEEEEECCCHHHHHHHHH
T ss_conf             9976644478888888656899996882999999970