BLAST/PSIBLAST alignment of GI: 254780497 and GI: 116251405 at iteration 1
>gi|116251405|ref|YP_767243.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium leguminosarum bv. viciae 3841] Length = 323
>gi|254783823|sp|Q1MIS6|FABH_RHIL3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName: Full=3-oxoacyl-[acyl-carrier-protein] synthase III; AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS III Length = 323
>gi|115256053|emb|CAK07134.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhizobium leguminosarum bv. viciae 3841] Length = 323
 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/324 (65%), Positives = 267/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNRDMEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDL+I ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALANGGLTPADIDLVICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA+ILE  E +G ++AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIILEATEGEG-TVADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ +KLYVDGGPST+ TVG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 180 GVLTAHLRSDGSHKEKLYVDGGPSTTGTVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I   KV++TVD+HGNTSAASIPLALA A  +GR+
Sbjct: 240 TADDLDWLVPHQANRRIIDGSAKKLNIDAAKVVITVDLHGNTSAASIPLALATAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323