BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780497|ref|YP_003064910.1| 3-oxoacyl-(acyl carrier
protein) synthase III [Candidatus Liberibacter asiaticus str. psy62]
         (324 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780497|ref|YP_003064910.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040174|gb|ACT56970.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 324

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA
Sbjct: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV
Sbjct: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT
Sbjct: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL
Sbjct: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV
Sbjct: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGDCLLLEAMGGGFTSGTVLLRW
Sbjct: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324


>gi|315122316|ref|YP_004062805.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495718|gb|ADR52317.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 323

 Score =  538 bits (1385), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 259/324 (79%), Positives = 298/324 (91%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G SLP++VLSN+DLESI+DTSD WI+RRVGIS+RHIAGK ETTASLGEAAA
Sbjct: 1   MIRSVVRGFGSSLPKKVLSNADLESIIDTSDDWIRRRVGISQRHIAGKGETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           RDAL+ A+M+ DDIDLII+ATSTPDQTFP+TAVN+QNRLGMK+GFAFD+QAVCSGF+YA+
Sbjct: 61  RDALYQAKMNADDIDLIILATSTPDQTFPATAVNVQNRLGMKKGFAFDIQAVCSGFLYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIRSGVV+RVMVIG+DTFSRI+DWSDRSTC+LFGDGAG+LILE  +V+ SS +D 
Sbjct: 121 TTADAYIRSGVVQRVMVIGADTFSRIIDWSDRSTCILFGDGAGSLILEATQVQ-SSDSDI 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILSTYL SDGS+I+KL+VDGGPSTS TVG +RM+G+ VFKYAVE A ELI+KV DS++L
Sbjct: 180 GILSTYLYSDGSHIEKLHVDGGPSTSGTVGYVRMKGREVFKYAVESAAELIKKVLDSSNL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           TI +IDWFVPHQAN RIINSI ++M I  DKVIVTVDIHGNTSAASIPLAL+VAVKEGR+
Sbjct: 240 TIADIDWFVPHQANLRIINSISERMNISSDKVIVTVDIHGNTSAASIPLALSVAVKEGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGDCLLLEAMGGGFTSG VLLRW
Sbjct: 300 KKGDCLLLEAMGGGFTSGAVLLRW 323


>gi|327189793|gb|EGE56934.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium etli
           CNPAF512]
          Length = 323

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 268/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVVTNRDMEAIVDTSDEWIVQRTGIRQRYLAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDLII ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALENGGLTPADIDLIICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E +G+S AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIVLEAAEGEGTS-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ DKLYVDGGPST+ +VG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 180 GVLTAHLRSDGSHKDKLYVDGGPSTTGSVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I  +KV+VTVD+HGNTSAASIPLALA A  +GR+
Sbjct: 240 TADDLDWLVPHQANRRIIDGSAKKLNIAAEKVVVTVDLHGNTSAASIPLALATAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|162329643|ref|YP_469062.2| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium etli CFN
           42]
          Length = 323

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 267/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +RH+AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNRDMEAIVDTSDEWIVQRTGIRQRHVAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  +   DIDLII ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALANGGLMPADIDLIICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E +G+S AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIVLEAAEGEGTS-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ DKLYVDGGPST+ +VG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 180 GVLTAHLRSDGSHKDKLYVDGGPSTTGSVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E++DW VPHQAN RII+    K+ I  DKV+VTVD+HGNTSAASIPLALA A  +GR+
Sbjct: 240 TAEDLDWLVPHQANRRIIDGSAKKLNIDADKVVVTVDLHGNTSAASIPLALATAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|325292553|ref|YP_004278417.1| 3-oxoacyl-acyl carrier protein synthase III [Agrobacterium sp.
           H13-3]
 gi|325060406|gb|ADY64097.1| 3-oxoacyl-acyl carrier protein synthase III [Agrobacterium sp.
           H13-3]
          Length = 323

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 216/324 (66%), Positives = 269/324 (83%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++NS++E +V+TSD WI +R GI +R+IAG+ ETTASLGEAAA
Sbjct: 1   MIRSIVRGFGAALPKRVMTNSEIEGVVETSDEWIVQRTGIRQRYIAGEGETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A ++ DDIDLII+ATSTPD TFP+TAVNIQNRLGM  GFAFDMQAVCSGFVYAV
Sbjct: 61  RAALDNAGLTPDDIDLIILATSTPDNTFPATAVNIQNRLGMTHGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD YIR G+ +RV+VIG++TFSRI+DW DR+TCVLFGDGAGAL++E  E +G+S +D 
Sbjct: 121 ATADLYIRGGMAKRVLVIGAETFSRILDWKDRTTCVLFGDGAGALVIEAGEGEGTS-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL++ L SDGS+ DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE+ F++T  
Sbjct: 180 GILTSQLRSDGSHKDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEQAFEATGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I  +KV++TVD HGNTSAASIPLALAVA  +GR+
Sbjct: 240 TADDLDWLVPHQANKRIIDGSAKKLNIDPEKVVITVDKHGNTSAASIPLALAVAASDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|209548800|ref|YP_002280717.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209534556|gb|ACI54491.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 331

 Score =  434 bits (1117), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 267/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 9   MIRSVVRGFGAALPKRVMTNGDMEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAA 68

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDLII ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 69  RAALANGGLTPADIDLIICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 128

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E +G ++AD 
Sbjct: 129 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIVLEATEGEG-TVADR 187

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ +KLYVDGGPST+ TVG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 188 GVLTAHLRSDGSHKEKLYVDGGPSTTGTVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 247

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E++DW VPHQAN RII+    K+ I   KV++TVD+HGNTSAASIPLALA A  +GR+
Sbjct: 248 TAEDLDWLVPHQANRRIIDGSAKKLNIDAAKVVITVDLHGNTSAASIPLALATAAGDGRI 307

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 308 KKGDLVMLEAMGGGFTWGAVLLRW 331


>gi|15888517|ref|NP_354198.1| 3-oxoacyl-(acyl carrier protein) synthase III [Agrobacterium
           tumefaciens str. C58]
 gi|34098610|sp|Q8UG62|FABH_AGRT5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|15156221|gb|AAK86983.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Agrobacterium
           tumefaciens str. C58]
          Length = 323

 Score =  432 bits (1111), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 268/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++NS++E +V+TSD WI +R GI +R+IAG+ ETTASLGEAAA
Sbjct: 1   MIRSIVRGFGAALPKRVMTNSEIEGVVETSDEWIVQRTGIRQRYIAGEGETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A ++  DIDLII+ATSTPD TFP+TAVNIQNRLGM  GFAFDMQAVCSGFVYAV
Sbjct: 61  RAALDNAGLTPADIDLIILATSTPDNTFPATAVNIQNRLGMTHGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD YIR G+ +RV+VIG++TFSRI+DW DR+TCVLFGDGAGAL++E  E +G+S +D 
Sbjct: 121 ATADLYIRGGMAKRVLVIGAETFSRILDWKDRTTCVLFGDGAGALVIEAGEGEGTS-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL++ L SDGS+ DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE+ F++T  
Sbjct: 180 GILTSQLRSDGSHKDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEQAFEATGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I  +KV++TVD HGNTSAASIPLALAVA  +GR+
Sbjct: 240 TADDLDWLVPHQANKRIIDGSAKKLNIDPEKVVITVDKHGNTSAASIPLALAVAASDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|116251405|ref|YP_767243.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|254783823|sp|Q1MIS6|FABH_RHIL3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|115256053|emb|CAK07134.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 323

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 213/324 (65%), Positives = 267/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNRDMEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDL+I ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALANGGLTPADIDLVICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA+ILE  E +G ++AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIILEATEGEG-TVADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ +KLYVDGGPST+ TVG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 180 GVLTAHLRSDGSHKEKLYVDGGPSTTGTVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I   KV++TVD+HGNTSAASIPLALA A  +GR+
Sbjct: 240 TADDLDWLVPHQANRRIIDGSAKKLNIDAAKVVITVDLHGNTSAASIPLALATAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|241204021|ref|YP_002975117.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240857911|gb|ACS55578.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 323

 Score =  431 bits (1107), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 267/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNRDMEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDL+I ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALANGGLTPADIDLVICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA+ILE  E +G +++D 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGAIILEATEGEG-TVSDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ +KLYVDGGPST+ TVG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 180 GVLTAHLRSDGSHKEKLYVDGGPSTTGTVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I   KV++TVD+HGNTSAASIPLALA A  +GR+
Sbjct: 240 TADDLDWLVPHQANRRIIDGSAKKLNIDAAKVVITVDLHGNTSAASIPLALATAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGAVLLRW 323


>gi|222148216|ref|YP_002549173.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Agrobacterium vitis
           S4]
 gi|254783782|sp|B9JV87|FABH_AGRVS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|221735204|gb|ACM36167.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Agrobacterium vitis
           S4]
          Length = 323

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 268/324 (82%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG+G +LP+R+LSN ++E++VDTSD WI +R GI +R+IAG+ ETTASLG  AA
Sbjct: 1   MIRSVVRGVGSALPKRLLSNREMETLVDTSDDWIVQRTGIKQRYIAGEGETTASLGAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A ++  DID+II ATSTPD TFPS AVNIQNRLGM  GFAFD+QAVC+GFVYA+
Sbjct: 61  LKALEAAGLAPADIDMIICATSTPDNTFPSAAVNIQNRLGMTHGFAFDVQAVCTGFVYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW DR+TCVLFGDGAGAL+LE VE +G ++AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWQDRTTCVLFGDGAGALVLEAVEGQG-TIADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE+ F ++ L
Sbjct: 180 GVLTAHLRSDGSHKDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMIADVIEQSFAASGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E++DW VPHQAN RII+    K+ IP +KV++TVD HGNTSAASIPLA++VAV +GR+
Sbjct: 240 TAEDVDWLVPHQANRRIIDGAAKKLDIPLEKVVITVDQHGNTSAASIPLAISVAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +LLEAMGGGFT G +LLRW
Sbjct: 300 KQGDLVLLEAMGGGFTWGALLLRW 323


>gi|319784145|ref|YP_004143621.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317170033|gb|ADV13571.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 323

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 216/324 (66%), Positives = 265/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LPRR++ N+D E +V+TSD WI +R GI +RHIAG DETTASLGEAAA
Sbjct: 1   MIRSVVRGTGAALPRRIMKNADFEGMVETSDEWIAQRTGIRQRHIAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A ++  DIDLI++ATSTP+ TFP+TAV IQNRLGM  GFAFDMQAVCSGFVYAV
Sbjct: 61  RAALANAGLTPADIDLIVLATSTPNNTFPATAVEIQNRLGMHHGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ +RV+VIGS+TFSRI+DWSDRSTCVLFGDGAGA+ILE  E  G ++AD 
Sbjct: 121 TTADLYIRGGLAKRVLVIGSETFSRILDWSDRSTCVLFGDGAGAMILEAGEGAG-TIADH 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ DKL+VDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F    +
Sbjct: 180 GVLAASLRSDGTHKDKLFVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEATFAQAGI 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DWFVPHQAN RII++   K+ I   KV+VTVD+HGNTSAAS+PLAL+VAV +GR+
Sbjct: 240 TADDLDWFVPHQANKRIIDASAKKLGIAEQKVVVTVDLHGNTSAASVPLALSVAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|227821545|ref|YP_002825515.1| 3-oxoacyl-(acyl carrier protein) synthase III [Sinorhizobium fredii
           NGR234]
 gi|227340544|gb|ACP24762.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sinorhizobium fredii
           NGR234]
          Length = 323

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 265/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N ++ES VDTSD WI +R GI +RHIAG+ ETTASLGE AA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNREMESKVDTSDEWIVQRTGIRQRHIAGEGETTASLGERAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A M+ DD+DLIIVATSTPD TFP+TAVNIQNRLGM+ G AFD+QAVCSGFVYAV
Sbjct: 61  RAALERAGMTADDLDLIIVATSTPDNTFPATAVNIQNRLGMRHGAAFDLQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+YIR G+ RR +VIG++TFSRI+DWSDR+TCVLFGDGAGA+ILEG   +G++ AD 
Sbjct: 121 ATADAYIRGGLARRALVIGAETFSRILDWSDRTTCVLFGDGAGAIILEGQRGEGTT-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG + DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F++T  
Sbjct: 180 GVLTAQLRSDGMHGDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEAAFEATGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +++DW VPHQAN RII+    K+ IP +KV+VTVD+HGNTSAASIPLAL  A  +GR+
Sbjct: 240 SADDVDWLVPHQANRRIIDGSAKKLGIPSEKVVVTVDLHGNTSAASIPLALDTAASDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G+VL+RW
Sbjct: 300 KKGDLVMLEAMGGGFTWGSVLIRW 323


>gi|260460935|ref|ZP_05809185.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium
           opportunistum WSM2075]
 gi|259033512|gb|EEW34773.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium
           opportunistum WSM2075]
          Length = 323

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP R++ N+D E +V+TSD WI +R GI +RHIA  DETTASLGEAAA
Sbjct: 1   MIRSVVRGTGAALPHRIMKNADFEGMVETSDEWIAQRTGIRQRHIAADDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A ++ DDIDLI++ATSTP+ TFP+TAV+IQNRLGM  GFAFDMQAVCSGFVYAV
Sbjct: 61  RAALADAGLTPDDIDLIVLATSTPNNTFPATAVDIQNRLGMHHGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ +RV+VIGS+TFSRI+DWSDRSTCVLFGDGAGAL+LE  E  G ++AD 
Sbjct: 121 TTADLYIRGGLAKRVLVIGSETFSRILDWSDRSTCVLFGDGAGALVLEAGEGSG-TIADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ DKL+VDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F    +
Sbjct: 180 GVLAASLRSDGAHKDKLFVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEATFSDAGI 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  ++DWFVPHQAN RII++   K+ I   KV+VTVD+HGNTSAAS+PLAL+VAV +GR+
Sbjct: 240 TAADLDWFVPHQANKRIIDASARKLGIDDQKVVVTVDLHGNTSAASVPLALSVAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|13476952|ref|NP_108522.1| 3-oxoacyl-(acyl carrier protein) synthase III [Mesorhizobium loti
           MAFF303099]
 gi|34098684|sp|Q982Z8|FABH_RHILO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|14027715|dbj|BAB54308.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mesorhizobium loti
           MAFF303099]
          Length = 323

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 214/324 (66%), Positives = 265/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG+G +LPRR++ N+D E +V+TSD WI +R GI +RHIA  DETTASLGEAAA
Sbjct: 1   MIRSVVRGMGAALPRRIMKNADFEGMVETSDEWIVQRTGIRQRHIAADDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A ++  DIDLI++ATSTP+ TFP+TAV IQNRLGM  GFAFDMQAVCSGFVYAV
Sbjct: 61  RAALANAGLTPGDIDLIVLATSTPNNTFPATAVEIQNRLGMHHGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ +RV+VIGS+TFSRI+DW+DRSTCVLFGDGAGALILE  E  G ++AD 
Sbjct: 121 TTADLYIRGGLAKRVLVIGSETFSRILDWNDRSTCVLFGDGAGALILEAGEGAG-TIADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG + DKL+VDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F +  +
Sbjct: 180 GVLAASLRSDGVHKDKLFVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEATFSAAGI 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +++DWFVPHQAN RII++   K+ I   KV+VTVD+HGNTSAAS+PLAL+VAV +GR+
Sbjct: 240 SADDLDWFVPHQANKRIIDASAKKLGIAEQKVVVTVDLHGNTSAASVPLALSVAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|222085522|ref|YP_002544052.1| 3-oxoacyl-(acyl-carrier-protein) synthase III protein
           [Agrobacterium radiobacter K84]
 gi|254783781|sp|B9JCY9|FABH_AGRRK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|221722970|gb|ACM26126.1| 3-oxoacyl-(acyl-carrier-protein) synthase III protein
           [Agrobacterium radiobacter K84]
          Length = 323

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/324 (65%), Positives = 264/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E +VDTSD WI +R GI +R+IAG+ ETTASLGE AA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNRDMEQVVDTSDDWIVQRTGIRQRYIAGEGETTASLGEQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A ++ DD+D+IIVATSTPD TFP+TAVNIQNRLGM  GFAFD+QAVCSGFVYAV
Sbjct: 61  RAALANAGLTADDLDMIIVATSTPDNTFPATAVNIQNRLGMHHGFAFDVQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR GV +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGALILE  E  G++  D 
Sbjct: 121 TTADAYIRGGVAKRVLVIGAETFSRILDWTDRTTCVLFGDGAGALILEAGEGTGAN-TDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ DKLYVDGGPS++ TVG + M G+ VFK+AV    ++IE  F +  +
Sbjct: 180 GVLTASLRSDGAHKDKLYVDGGPSSTGTVGVLHMAGREVFKHAVGMITDVIEATFKAADV 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I  +KV+VTVD+HGNTSAASIPLALAVA  +GR+
Sbjct: 240 TADDLDWLVPHQANRRIIDGSAKKLGIAPEKVVVTVDLHGNTSAASIPLALAVAAGDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEAMGGGFT G VLLRW
Sbjct: 300 KRGDLVMLEAMGGGFTWGAVLLRW 323


>gi|163843048|ref|YP_001627452.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella suis ATCC
           23445]
 gi|254783791|sp|B0CLA2|FABH_BRUSI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|163673771|gb|ABY37882.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella suis ATCC
           23445]
          Length = 323

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 264/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGEGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILATNLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|148559178|ref|YP_001258755.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella ovis ATCC
           25840]
 gi|254783790|sp|A5VPV8|FABH_BRUO2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|148370435|gb|ABQ60414.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella ovis ATCC
           25840]
          Length = 323

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAGK ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGKGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|17987463|ref|NP_540097.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           bv. 1 str. 16M]
 gi|62289728|ref|YP_221521.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           1 str. 9-941]
 gi|82699657|ref|YP_414231.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           biovar Abortus 2308]
 gi|189023977|ref|YP_001934745.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus
           S19]
 gi|225627275|ref|ZP_03785312.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella ceti str.
           Cudo]
 gi|237815216|ref|ZP_04594214.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella abortus
           str. 2308 A]
 gi|254689037|ref|ZP_05152291.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           6 str. 870]
 gi|254693520|ref|ZP_05155348.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           3 str. Tulya]
 gi|254697172|ref|ZP_05159000.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254701550|ref|ZP_05163378.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella suis bv. 5
           str. 513]
 gi|254707001|ref|ZP_05168829.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella
           pinnipedialis M163/99/10]
 gi|254709890|ref|ZP_05171701.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella
           pinnipedialis B2/94]
 gi|254713891|ref|ZP_05175702.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella ceti
           M644/93/1]
 gi|254717052|ref|ZP_05178863.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella ceti
           M13/05/1]
 gi|254718894|ref|ZP_05180705.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella sp. 83/13]
 gi|254730068|ref|ZP_05188646.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           4 str. 292]
 gi|256031383|ref|ZP_05444997.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella
           pinnipedialis M292/94/1]
 gi|256044462|ref|ZP_05447366.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256060894|ref|ZP_05451052.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella neotomae
           5K33]
 gi|256113306|ref|ZP_05454174.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159504|ref|ZP_05457272.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella ceti
           M490/95/1]
 gi|256254790|ref|ZP_05460326.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella ceti B1/94]
 gi|256257287|ref|ZP_05462823.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella abortus bv.
           9 str. C68]
 gi|256369209|ref|YP_003106717.1| 3-oxoacyl-(acyl carrier protein) synthase [Brucella microti CCM
           4915]
 gi|260168516|ref|ZP_05755327.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella sp. F5/99]
 gi|260545519|ref|ZP_05821260.1| naringenin-chalcone synthase [Brucella abortus NCTC 8038]
 gi|260563813|ref|ZP_05834299.1| naringenin-chalcone synthase [Brucella melitensis bv. 1 str. 16M]
 gi|260754532|ref|ZP_05866880.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 6 str. 870]
 gi|260757753|ref|ZP_05870101.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 4 str. 292]
 gi|260761578|ref|ZP_05873921.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883560|ref|ZP_05895174.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella abortus bv. 9
           str. C68]
 gi|261213780|ref|ZP_05928061.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 3 str. Tulya]
 gi|261218862|ref|ZP_05933143.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M13/05/1]
 gi|261221970|ref|ZP_05936251.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella ceti B1/94]
 gi|261314468|ref|ZP_05953665.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella pinnipedialis
           M163/99/10]
 gi|261317432|ref|ZP_05956629.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella pinnipedialis
           B2/94]
 gi|261321639|ref|ZP_05960836.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M644/93/1]
 gi|261324890|ref|ZP_05964087.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella neotomae 5K33]
 gi|261752099|ref|ZP_05995808.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 5
           str. 513]
 gi|261757986|ref|ZP_06001695.1| naringenin-chalcone synthase [Brucella sp. F5/99]
 gi|265983879|ref|ZP_06096614.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella sp. 83/13]
 gi|265988469|ref|ZP_06101026.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella pinnipedialis
           M292/94/1]
 gi|265990883|ref|ZP_06103440.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|265994719|ref|ZP_06107276.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella melitensis bv.
           3 str. Ether]
 gi|265997933|ref|ZP_06110490.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M490/95/1]
 gi|297248133|ref|ZP_06931851.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella abortus bv. 5
           str. B3196]
 gi|306838204|ref|ZP_07471058.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella sp. NF
           2653]
 gi|34098631|sp|Q8YGH9|FABH_BRUME RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|75496992|sp|Q57DX4|FABH_BRUAB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|123546608|sp|Q2YNB9|FABH_BRUA2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|254783787|sp|B2S524|FABH_BRUA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|17983158|gb|AAL52361.1| 3-oxoacyl-(acyl-carrier-protein) synthase iii [Brucella melitensis
           bv. 1 str. 16M]
 gi|62195860|gb|AAX74160.1| FabH, 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615758|emb|CAJ10754.1| Naringenin-chalcone synthase:Beta-ketoacyl-acyl carrier protein
           synthase III (FabH) [Brucella melitensis biovar Abortus
           2308]
 gi|189019549|gb|ACD72271.1| Naringenin-chalcone synthase [Brucella abortus S19]
 gi|225617280|gb|EEH14325.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella ceti str.
           Cudo]
 gi|237790053|gb|EEP64263.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella abortus
           str. 2308 A]
 gi|255999369|gb|ACU47768.1| 3-oxoacyl-(acyl carrier protein) synthase [Brucella microti CCM
           4915]
 gi|260096926|gb|EEW80801.1| naringenin-chalcone synthase [Brucella abortus NCTC 8038]
 gi|260153829|gb|EEW88921.1| naringenin-chalcone synthase [Brucella melitensis bv. 1 str. 16M]
 gi|260668071|gb|EEX55011.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 4 str. 292]
 gi|260672010|gb|EEX58831.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260674640|gb|EEX61461.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 6 str. 870]
 gi|260873088|gb|EEX80157.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella abortus bv. 9
           str. C68]
 gi|260915387|gb|EEX82248.1| beta-ketoacyl-ACP synthase III [Brucella abortus bv. 3 str. Tulya]
 gi|260920554|gb|EEX87207.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella ceti B1/94]
 gi|260923951|gb|EEX90519.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M13/05/1]
 gi|261294329|gb|EEX97825.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M644/93/1]
 gi|261296655|gb|EEY00152.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella pinnipedialis
           B2/94]
 gi|261300870|gb|EEY04367.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella neotomae 5K33]
 gi|261303494|gb|EEY06991.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella pinnipedialis
           M163/99/10]
 gi|261737970|gb|EEY25966.1| naringenin-chalcone synthase [Brucella sp. F5/99]
 gi|261741852|gb|EEY29778.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 5
           str. 513]
 gi|262552401|gb|EEZ08391.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella ceti
           M490/95/1]
 gi|262765832|gb|EEZ11621.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella melitensis bv.
           3 str. Ether]
 gi|263001667|gb|EEZ14242.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|264660666|gb|EEZ30927.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Brucella pinnipedialis
           M292/94/1]
 gi|264662471|gb|EEZ32732.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella sp. 83/13]
 gi|297175302|gb|EFH34649.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella abortus bv. 5
           str. B3196]
 gi|306406713|gb|EFM62938.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella sp. NF
           2653]
          Length = 323

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/324 (63%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGEGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|218509113|ref|ZP_03506991.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhizobium etli
           Brasil 5]
          Length = 324

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/324 (62%), Positives = 254/324 (78%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N D+E+IVDTSD WI +R GI +R++AG DETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVVTNRDMEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +  ++  DIDLII ATSTPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAV
Sbjct: 61  RAALENGGLTPADIDLIICATSTPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLF                 + AD 
Sbjct: 121 TTADAYIRGGLAKRVLVIGAETFSRILDWNDRTTCVLFRRRRRRDSCWRRPKARGTSADR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+ +L SDGS+ DKLYVDGGPST+ +VG +RMEG+ VFKYAV    ++I+  FDST  
Sbjct: 181 GVLTAHLRSDGSHKDKLYVDGGPSTTGSVGKLRMEGREVFKYAVGMITDVIQAAFDSTGT 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DW VPHQAN RII+    K+ I  +KV+VTVD+HGNTSAASIPLALA A  +GR+
Sbjct: 241 TADDLDWLVPHQANRRIIDGSAKKLNIAAEKVVVTVDLHGNTSAASIPLALATAAGDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G VLLRW
Sbjct: 301 KKGDLVMLEAMGGGFTWGAVLLRW 324


>gi|306843720|ref|ZP_07476320.1| 3-oxoacyl-acyl-carrier-protein synthase III [Brucella sp. BO1]
 gi|306276030|gb|EFM57739.1| 3-oxoacyl-acyl-carrier-protein synthase III [Brucella sp. BO1]
          Length = 323

 Score =  421 bits (1082), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/324 (63%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGEGETTVSLGTAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|153009846|ref|YP_001371061.1| 3-oxoacyl-(acyl carrier protein) synthase III [Ochrobactrum
           anthropi ATCC 49188]
 gi|254783817|sp|A6X1X8|FABH_OCHA4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|151561734|gb|ABS15232.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ochrobactrum
           anthropi ATCC 49188]
          Length = 323

 Score =  421 bits (1081), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/324 (63%), Positives = 261/324 (80%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E I++TSD WI +R GI  RHIAG DETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIIETSDEWIVQRTGIRERHIAGDDETTVSLGTAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ +GFAFDMQAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPTDIDLVLLATSTPNHTFPASAVEIQRELGITKGFAFDMQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ +RV+VIG++TFSRI+DW+DR+TCVLFGDGAGAL+LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMAKRVLVIGAETFSRILDWNDRTTCVLFGDGAGALVLEAAEGNGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ +KL+VDGGPST++TVG +RMEG+ VFK+AV    ++IE  F+ T L
Sbjct: 180 GVLAANLRSDGNHKEKLFVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEETGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I   KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLNIAEGKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VLLRW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLLRW 323


>gi|150396053|ref|YP_001326520.1| 3-oxoacyl-(acyl carrier protein) synthase III [Sinorhizobium
           medicae WSM419]
 gi|254783824|sp|A6U7Q5|FABH_SINMW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|150027568|gb|ABR59685.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sinorhizobium
           medicae WSM419]
          Length = 323

 Score =  421 bits (1081), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/324 (66%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N ++ES VDTSD WI +R GI +R+IAG  ETTASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNKEMESKVDTSDEWIVQRTGIRQRYIAGDGETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A ++ DDIDLIIVATSTPD TFP+TAVNIQNRLGM+ G AFDMQAVCSGFVYAV
Sbjct: 61  RAALERAGLTPDDIDLIIVATSTPDNTFPATAVNIQNRLGMRHGAAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT D+YIR G+  RV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G+  AD 
Sbjct: 121 TTGDAYIRGGLATRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAQEGAGTK-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F++T  
Sbjct: 180 GVLTAQLRSDGAHGDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEAAFEATGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T ++IDW VPHQAN RII     K+ IP +KV+VTVD+HGNTSAASIPLAL  A  +GR+
Sbjct: 240 TADDIDWLVPHQANRRIIEGSAKKLGIPLEKVVVTVDLHGNTSAASIPLALDAAATDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEAMGGGFT G+VLLRW
Sbjct: 300 KRGDLVMLEAMGGGFTWGSVLLRW 323


>gi|225852292|ref|YP_002732525.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           ATCC 23457]
 gi|256264203|ref|ZP_05466735.1| naringenin-chalcone synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|254783789|sp|C0RIB3|FABH_BRUMB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|225640657|gb|ACO00571.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella melitensis
           ATCC 23457]
 gi|263094447|gb|EEZ18269.1| naringenin-chalcone synthase [Brucella melitensis bv. 2 str. 63/9]
 gi|326408796|gb|ADZ65861.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella melitensis
           M28]
 gi|326538515|gb|ADZ86730.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella melitensis
           M5-90]
          Length = 323

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/324 (63%), Positives = 263/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E I++TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIIETSDEWIVQRTGIRERHIAGEGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|15964976|ref|NP_385329.1| 3-oxoacyl-(acyl carrier protein) synthase III [Sinorhizobium
           meliloti 1021]
 gi|307301047|ref|ZP_07580816.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sinorhizobium
           meliloti BL225C]
 gi|307317781|ref|ZP_07597219.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sinorhizobium
           meliloti AK83]
 gi|34098669|sp|Q92QT4|FABH_RHIME RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|15074155|emb|CAC45802.1| Probable 3-oxoacyl-acyl-carrier-protein synthase III [Sinorhizobium
           meliloti 1021]
 gi|306896543|gb|EFN27291.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sinorhizobium
           meliloti AK83]
 gi|306904002|gb|EFN34588.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sinorhizobium
           meliloti BL225C]
          Length = 323

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/324 (65%), Positives = 265/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRG G +LP+RV++N ++ES VDTSD WI +R GI +R+IAG+ ET+ASLGEAAA
Sbjct: 1   MIRSVVRGFGAALPKRVMTNKEIESRVDTSDEWIVQRTGIRQRYIAGEGETSASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A ++ DD+DLIIVATSTPD TFP+TAVNIQNRLGM+ G AFDMQAVCSGFVYAV
Sbjct: 61  RAALERAGLTPDDVDLIIVATSTPDNTFPATAVNIQNRLGMRHGAAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+YIR G+ +R +VIG++TFSR++DW+DR+TCVLFGDGAGA++LE  E  G+  AD 
Sbjct: 121 ATADAYIRGGLSKRALVIGAETFSRLLDWTDRTTCVLFGDGAGAIVLEAQEAAGTK-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+  L SDG++ DKLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F++T  
Sbjct: 180 GVLTAQLRSDGAHRDKLYVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEAAFEATGT 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T ++IDW VPHQAN RII+    K+ IP +KV+VTVD+HGNTSAASIPLAL  A  +GR+
Sbjct: 240 TADDIDWLVPHQANRRIIDGSAKKLGIPLEKVVVTVDLHGNTSAASIPLALDAAASDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G+VLLRW
Sbjct: 300 KKGDLVMLEAMGGGFTWGSVLLRW 323


>gi|110633499|ref|YP_673707.1| 3-oxoacyl-(acyl carrier protein) synthase III [Mesorhizobium sp.
           BNC1]
 gi|122966093|sp|Q11J83|FABH_MESSB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|110284483|gb|ABG62542.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Chelativorans sp.
           BNC1]
          Length = 323

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/324 (64%), Positives = 265/324 (81%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRSTVRG+G +LPRRV++N DLE+ ++TSD WI +R GI +RHIA  DETTASLGEAAA
Sbjct: 1   MIRSTVRGVGAALPRRVVTNKDLETRLETSDEWIVQRTGIRQRHIASDDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A ++  DIDLI+VATSTP+ TFP+TAV IQ RLG+++GFAFDMQAVCSGFVYAV
Sbjct: 61  LRALDAAGLAPADIDLIVVATSTPNNTFPATAVEIQERLGIRQGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E +G  ++D 
Sbjct: 121 TTADLYIRGGMAKRALVIGAETFSRILDWTDRTTCVLFGDGAGAIVLEAEEGQG-DISDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDGS+ +KLYVDGGPST+RTVG +RM+G+ VFK+AV    ++IE VF    +
Sbjct: 180 GILAEALRSDGSHKEKLYVDGGPSTTRTVGHLRMQGREVFKHAVGMITDVIEDVFGQAGI 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFV HQAN RII++   K+ I  +KV++TVD+HGNTSAAS+PLAL  AV +G++
Sbjct: 240 TAEDIDWFVSHQANKRIIDASAKKLGIAEEKVVITVDLHGNTSAASVPLALNHAVSQGKI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KGD +LLEAMGGGFT G VLLRW
Sbjct: 300 QKGDLVLLEAMGGGFTWGAVLLRW 323


>gi|294852137|ref|ZP_06792810.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella sp. NVSL
           07-0026]
 gi|294820726|gb|EFG37725.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella sp. NVSL
           07-0026]
          Length = 323

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/324 (63%), Positives = 262/324 (80%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGEGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSRILDWIDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|23501664|ref|NP_697791.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella suis 1330]
 gi|161618743|ref|YP_001592630.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella canis ATCC
           23365]
 gi|254704098|ref|ZP_05165926.1| 3-oxoacyl-(acyl carrier protein) synthase III [Brucella suis bv. 3
           str. 686]
 gi|260566654|ref|ZP_05837124.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 4
           str. 40]
 gi|261754758|ref|ZP_05998467.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 3
           str. 686]
 gi|34098560|sp|Q8G1E0|FABH_BRUSU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|254783788|sp|A9MAF6|FABH_BRUC2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|23347584|gb|AAN29706.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella suis 1330]
 gi|161335554|gb|ABX61859.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brucella canis ATCC
           23365]
 gi|260156172|gb|EEW91252.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 4
           str. 40]
 gi|261744511|gb|EEY32437.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Brucella suis bv. 3
           str. 686]
          Length = 323

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/324 (63%), Positives = 262/324 (80%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP+RV+ N+D E IV+TSD WI +R GI  RHIAG+ ETT SLG AAA
Sbjct: 1   MIRSVVRGIGSALPKRVMKNTDFEGIVETSDEWIVQRTGIRERHIAGEGETTVSLGAAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+ +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+
Sbjct: 61  RAAIENAGLQPSDIDLVLLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD YIR G+ RRV+VIG++TFS I+DW+DR+TCVLFGDGAGA++LE  E  G + +D 
Sbjct: 121 TTADLYIRGGMARRVLVIGAETFSHILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+  L SDG++ +KLYVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T L
Sbjct: 180 GILAANLRSDGNHKEKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E+IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+
Sbjct: 240 TAEDIDWFVPHQANKRIIDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|190891217|ref|YP_001977759.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein [Rhizobium
           etli CIAT 652]
 gi|190696496|gb|ACE90581.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein [Rhizobium
           etli CIAT 652]
          Length = 301

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/302 (66%), Positives = 250/302 (82%), Gaps = 1/302 (0%)

Query: 23  LESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATS 82
           +E+IVDTSD WI +R GI +R++AG DETTASLGEAAAR AL +  ++  DIDLII ATS
Sbjct: 1   MEAIVDTSDEWIVQRTGIRQRYVAGDDETTASLGEAAARAALENGGLTPADIDLIICATS 60

Query: 83  TPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDT 142
           TPD TFP+T+VNIQ+RLGM  GFAFD+QAVC+GFVYAVTTAD+YIR G+ +RV+VIG++T
Sbjct: 61  TPDNTFPATSVNIQDRLGMSHGFAFDVQAVCTGFVYAVTTADAYIRGGLAKRVLVIGAET 120

Query: 143 FSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGG 202
           FSRI+DW+DR+TCVLFGDGAGA++LE  E +G+S AD G+L+ +L SDGS+ DKLYVDGG
Sbjct: 121 FSRILDWNDRTTCVLFGDGAGAIVLEAAEGEGTS-ADRGVLTAHLRSDGSHKDKLYVDGG 179

Query: 203 PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIV 262
           PST+ +VG +RMEG+ VFKYAV    ++I+  FDST  T +++DW VPHQAN RII+   
Sbjct: 180 PSTTGSVGKLRMEGREVFKYAVGMITDVIQAAFDSTGTTADDLDWLVPHQANRRIIDGSA 239

Query: 263 DKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLL 322
            K+ I  +KV+VTVD+HGNTSAASIPLALA A  +GR+KKGD ++LEAMGGGFT G VLL
Sbjct: 240 KKLNIAAEKVVVTVDLHGNTSAASIPLALATAAGDGRIKKGDLVMLEAMGGGFTWGAVLL 299

Query: 323 RW 324
           RW
Sbjct: 300 RW 301


>gi|239831602|ref|ZP_04679931.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ochrobactrum
           intermedium LMG 3301]
 gi|239823869|gb|EEQ95437.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ochrobactrum
           intermedium LMG 3301]
          Length = 318

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 203/319 (63%), Positives = 257/319 (80%), Gaps = 1/319 (0%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           +RGIG +LP+RV+ N+D E I++TSD WI +R GI  RHIAG DETT SLG AAAR A+ 
Sbjct: 1   MRGIGSALPKRVMKNTDFEGIIETSDEWIVQRTGIRERHIAGDDETTVSLGTAAARAAIE 60

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
           +A +   DIDL+++ATSTP+ TFP++AV IQ  LG+  GFAFDMQAVCSGF+YA+TTAD 
Sbjct: 61  NAGLQPTDIDLVLLATSTPNHTFPASAVEIQRELGITTGFAFDMQAVCSGFIYAITTADL 120

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           YIR G+ +RV+VIG++TFSRI+DWSDR+TCVLFGDGAGAL+LE  E  G + +D G+L+ 
Sbjct: 121 YIRGGMAKRVLVIGAETFSRILDWSDRTTCVLFGDGAGALVLEAAEGNGLT-SDRGVLAA 179

Query: 186 YLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENI 245
            L SDG++ +KL+VDGGPST++TVG +RMEG+ VFK+AV    ++IE  FD T LT E+I
Sbjct: 180 NLRSDGNHKEKLFVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFDETGLTAEDI 239

Query: 246 DWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDC 305
           DWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAAS+PLALA AV +GR+KKGD 
Sbjct: 240 DWFVPHQANKRIIDASAKKLNIAENKVVITVDRHGNTSAASVPLALATAVADGRIKKGDL 299

Query: 306 LLLEAMGGGFTSGTVLLRW 324
           +LLEAMGGGFT G VLLRW
Sbjct: 300 VLLEAMGGGFTWGAVLLRW 318


>gi|163759218|ref|ZP_02166304.1| 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phototrophica
           DFL-43]
 gi|162283622|gb|EDQ33907.1| 3-oxoacyl-(acyl carrier protein) synthase [Hoeflea phototrophica
           DFL-43]
          Length = 306

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/307 (66%), Positives = 250/307 (81%), Gaps = 1/307 (0%)

Query: 18  LSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLI 77
           + NSDLESIV+T+D WI +R GI +RHIAG+ ETTASLGE AAR AL  A M+  DIDLI
Sbjct: 1   MKNSDLESIVETNDDWIVQRTGIRQRHIAGEQETTASLGEMAARAALERANMTPADIDLI 60

Query: 78  IVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMV 137
           I ATSTPD TFP+TAVNIQ+RLGM  G AFD+QAVCSGFV+AVTTADSYI+SG+ RRV+V
Sbjct: 61  ICATSTPDNTFPATAVNIQDRLGMHHGAAFDVQAVCSGFVFAVTTADSYIKSGLARRVLV 120

Query: 138 IGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKL 197
           IG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G ++AD G+L+ +L SDG++  KL
Sbjct: 121 IGAETFSRILDWTDRTTCVLFGDGAGAIVLEAEEGSG-TVADRGVLTAHLRSDGAHRKKL 179

Query: 198 YVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRI 257
           YVDGGPST+ TVG +RMEG+ VFK+AV    ++IE  + +T L  E+IDWFVPHQAN RI
Sbjct: 180 YVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEAAYGATGLGSEDIDWFVPHQANRRI 239

Query: 258 INSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTS 317
           I++   K+ I   KV++TVD HGNTSAASIPLAL  A  +GR+KKGD +LLEAMGGGFT 
Sbjct: 240 IDASAKKLGIDDKKVVITVDKHGNTSAASIPLALNDAASDGRIKKGDLVLLEAMGGGFTW 299

Query: 318 GTVLLRW 324
           G+VLLRW
Sbjct: 300 GSVLLRW 306


>gi|319408455|emb|CBI82110.1| acyl-carrier-protein [Bartonella schoenbuchensis R1]
          Length = 324

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 257/324 (79%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS + G+G +LP+R LSN ++   V+TSD WI +R GI +R+IA  +ETT SLG AAA
Sbjct: 1   MIRSVICGVGSALPKRSLSNDEITKFVETSDSWIVQRTGIRQRYIADTNETTVSLGVAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL ++ M+++DID II+ATSTP+ TFP++AV IQ+ LGMK GFAFD+QAVCSGF++A+
Sbjct: 61  QAALENSGMTIEDIDCIILATSTPNHTFPASAVEIQHALGMKHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT D Y+R G  +R++VIGS+TFSRI+DW DR+TCVLFGDGAGA ILE  EV+G+ + D+
Sbjct: 121 TTGDVYLRCGAAKRILVIGSETFSRILDWQDRTTCVLFGDGAGAAILEAQEVEGNVIVDS 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L S+G+Y+DKLYVDGGPST++T G +RM+G+ VFK+AV    ++I+  F + ++
Sbjct: 181 GILSAKLRSNGAYVDKLYVDGGPSTTQTTGHLRMKGREVFKHAVGMITDVIDDCFAAVNM 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               ++WFVPHQAN RII +   K+ I  DKV++TVD HGNTSAAS+PLAL  AV++GR+
Sbjct: 241 NSSQLNWFVPHQANRRIIEASAKKLGITLDKVVMTVDQHGNTSAASVPLALTTAVQDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 301 KKGDLVMLEAMGGGFTWGAILVRW 324


>gi|163868459|ref|YP_001609668.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella
           tribocorum CIP 105476]
 gi|254783785|sp|A9IVB4|FABH_BART1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|161018115|emb|CAK01673.1| acyl-carrier-protein [Bartonella tribocorum CIP 105476]
          Length = 324

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/324 (59%), Positives = 252/324 (77%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS +RG+G +LP+R LSN +L   V+TSD WI +R GI +R+IA ++ETT SLG  AA
Sbjct: 1   MIRSIIRGVGSALPKRSLSNDELAKFVETSDAWIVQRTGIHQRYIANENETTVSLGVKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +++ DID II+ATSTP++TFP++AV IQ  LGM  GFAFD+QAVCSGF++A+
Sbjct: 61  QAALINAGLTIKDIDCIILATSTPNRTFPASAVEIQYALGMNHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT DSY+R G  +R++VIGSDTFSRI+DW DR+TCVLFGDGAGA +LE  E++G      
Sbjct: 121 TTGDSYLRCGAAKRILVIGSDTFSRILDWEDRTTCVLFGDGAGAAVLEAEEIEGGIAFQR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L SDG+YIDKLYVDGGPST++T G +RMEG+ VFKYAV    ++++  F +  +
Sbjct: 181 GILSAKLRSDGAYIDKLYVDGGPSTTQTTGYLRMEGREVFKYAVGMITDVVDDCFAAAGM 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+KI  DKV++TVD HGNTSAAS+PLAL  A+ +GR+
Sbjct: 241 DSSQLDWFVPHQANKRIIEASAKKLKISSDKVVITVDKHGNTSAASVPLALTTALCDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEAMGGGFT G +L+RW
Sbjct: 301 KRGDLIMLEAMGGGFTWGAILIRW 324


>gi|49474168|ref|YP_032210.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella quintana
           str. Toulouse]
 gi|81647097|sp|Q6G000|FABH_BARQU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|49239672|emb|CAF26043.1| 3-oxoacyl-[acyl-carrier-protein ] synthase III [Bartonella quintana
           str. Toulouse]
          Length = 324

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 253/324 (78%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS +RG+G +LP++ LSN ++   V+TSD WI +R GI +R+IA ++ETT SLG  AA
Sbjct: 1   MIRSVIRGVGSALPKKSLSNDEIAKFVETSDSWIVQRTGIRQRYIANENETTVSLGVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A +++ DID II+ATSTP+ TFP++AV IQ+ LGM  GFAFD+QAVCSGF++A+
Sbjct: 61  RVALINANLTIKDIDCIILATSTPNHTFPASAVEIQHALGMSHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT D+Y+RSGV +R++VIGS+TFSRI+DW DR+TCVLFGDGAGA++LE  E++     + 
Sbjct: 121 TTGDAYLRSGVAKRILVIGSETFSRILDWKDRTTCVLFGDGAGAVVLEAQEIQSDVALEC 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L S+G+Y++KLYVDGGPST++T G +RMEG+ VFKYAV    + ++  F +  +
Sbjct: 181 GILSAKLYSNGAYVNKLYVDGGPSTTQTTGYLRMEGREVFKYAVCMITDAVDDCFAAAGI 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  DKVI+TVD HGNTSAAS+PLAL  A+ +GR+
Sbjct: 241 NSSQLDWFVPHQANKRIIEASAKKLGISMDKVIITVDQHGNTSAASVPLALTTAICDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 301 KKGDLVMLEAMGGGFTWGAILIRW 324


>gi|86281272|gb|ABC90335.1| 3-oxoacyl-(acyl-carrier-protein) synthase III protein [Rhizobium
           etli CFN 42]
          Length = 301

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 204/302 (67%), Positives = 249/302 (82%), Gaps = 1/302 (0%)

Query: 23  LESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATS 82
           +E+IVDTSD WI +R GI +RH+AG DETTASLGEAAAR AL +  +   DIDLII ATS
Sbjct: 1   MEAIVDTSDEWIVQRTGIRQRHVAGDDETTASLGEAAARAALANGGLMPADIDLIICATS 60

Query: 83  TPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDT 142
           TPD TFP+T+VNIQNRLGM  GFAFD+QAVC+GFVYAVTTAD+YIR G+ +RV+VIG++T
Sbjct: 61  TPDNTFPATSVNIQNRLGMSHGFAFDVQAVCTGFVYAVTTADAYIRGGLAKRVLVIGAET 120

Query: 143 FSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGG 202
           FSRI+DW+DR+TCVLFGDGAGA++LE  E +G+S AD G+L+ +L SDGS+ DKLYVDGG
Sbjct: 121 FSRILDWNDRTTCVLFGDGAGAIVLEAAEGEGTS-ADRGVLTAHLRSDGSHKDKLYVDGG 179

Query: 203 PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIV 262
           PST+ +VG +RMEG+ VFKYAV    ++I+  FDST  T E++DW VPHQAN RII+   
Sbjct: 180 PSTTGSVGKLRMEGREVFKYAVGMITDVIQAAFDSTGTTAEDLDWLVPHQANRRIIDGSA 239

Query: 263 DKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLL 322
            K+ I  DKV+VTVD+HGNTSAASIPLALA A  +GR+KKGD ++LEAMGGGFT G VLL
Sbjct: 240 KKLNIDADKVVVTVDLHGNTSAASIPLALATAAGDGRIKKGDLVMLEAMGGGFTWGAVLL 299

Query: 323 RW 324
           RW
Sbjct: 300 RW 301


>gi|240850683|ref|YP_002972083.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella grahamii
           as4aup]
 gi|240267806|gb|ACS51394.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella grahamii
           as4aup]
          Length = 324

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 252/324 (77%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS +RG+G +LP+R LSN ++   V+TSD WI +R GI +R+IA ++ETT SLG  AA
Sbjct: 1   MIRSIIRGVGSALPKRSLSNDEIAKFVETSDSWIVQRTGIRQRYIASENETTVSLGVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +++ DID II+ATSTP++TFP++AV IQ  LGM  GFAFD+QAVCSGF++A+
Sbjct: 61  QAALTNAGLTIKDIDCIILATSTPNRTFPASAVEIQCALGMSHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT DSY+R G  +R++VIGSDTFSRI+DW DR+TCVLFGDGAGA ILE  E++G    + 
Sbjct: 121 TTGDSYLRCGAAKRILVIGSDTFSRILDWEDRTTCVLFGDGAGAAILEAQEIEGGIAFER 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L S+G+YIDKLYVDGGPST++T G +RMEG+ VFKYAV    ++++  F +  +
Sbjct: 181 GILSAKLRSNGAYIDKLYVDGGPSTTQTTGYLRMEGREVFKYAVGMITDVVDDCFAAAGM 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  DKV++TVD HGNTSAAS+PLAL  AV +G++
Sbjct: 241 DSSQLDWFVPHQANKRIIEASAKKLGISLDKVVITVDQHGNTSAASVPLALTTAVCDGKI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEAMGGGFT G +L+RW
Sbjct: 301 KEGDLIMLEAMGGGFTWGAILIRW 324


>gi|304391931|ref|ZP_07373873.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Ahrensia sp. R2A130]
 gi|303296160|gb|EFL90518.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Ahrensia sp. R2A130]
          Length = 323

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 260/324 (80%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS + G G + PR V++N++LE  V+TSD WI++R GI +R IA  DETTASLGE AA
Sbjct: 1   MIRSIIVGSGAAKPRNVVTNAELEKRVETSDEWIRQRTGIEQRWIAEDDETTASLGENAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A+++ DDIDLII+ATSTP+ TFP++AV IQNRLGM  G AFDMQAVCSGFVYA+
Sbjct: 61  RAALKDADLTPDDIDLIILATSTPNNTFPASAVEIQNRLGMTHGAAFDMQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD++I++G  +RV+VIGS+TFSRI+DW DR+TCVLFGDGAGA+++E  +  G S  D 
Sbjct: 121 TTADAFIQAGQAKRVLVIGSETFSRILDWEDRTTCVLFGDGAGAVVVERGDGVGMS-NDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+++L SDGS+ DKL+VDGGPST+ TVG +RM+G+ VFK+AV    ++IE  F +T L
Sbjct: 180 GILTSHLRSDGSHKDKLFVDGGPSTTGTVGHLRMQGRDVFKHAVAMITDVIEDAFSATGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
             ++IDWF+PHQAN RII++   K+ I  +KV++TV  HGNTSAASIP A+ VAV++GR+
Sbjct: 240 NADDIDWFIPHQANKRIIDASAKKLNIAPEKVVMTVAEHGNTSAASIPQAIDVAVRDGRL 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G VL+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGAVLVRW 323


>gi|49475534|ref|YP_033575.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella henselae
           str. Houston-1]
 gi|81647943|sp|Q6G3K4|FABH_BARHE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|49238340|emb|CAF27564.1| 3-oxoacyl-[acyl-carrier-protein ] synthase III [Bartonella henselae
           str. Houston-1]
          Length = 324

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 253/324 (78%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS VRGIG +LP++ LSN D+   V+TSD WI +R GI +R+IA + ETT SLG  AA
Sbjct: 1   MIRSVVRGIGGALPKKSLSNDDIAKFVETSDSWIVQRTGIRQRYIANEKETTVSLGVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +++ DID II+ATSTP+ TFP++AV IQ+ LGM  GFAFD+QAVCSGF++A+
Sbjct: 61  QAALINAGLTIKDIDCIILATSTPNHTFPASAVEIQHALGMSHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TT D+Y+R G  +R++VIGSDTFSRI+DW DR+TCVLFGDGAGA +LE  E++    +D 
Sbjct: 121 TTGDAYLRCGTAKRILVIGSDTFSRILDWQDRTTCVLFGDGAGAAVLEAQEIERGVASDH 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST L S+G+Y+DKLYVDGGPST++  G +RMEG+ VFKYAV    +++++ F +  +
Sbjct: 181 GILSTKLRSNGAYMDKLYVDGGPSTTQKTGYLRMEGREVFKYAVGMITDVVDECFAAAGM 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  DKV++TVD HGNTSAAS+PLAL +A+ +G++
Sbjct: 241 DSSQLDWFVPHQANKRIIEASAKKLGISIDKVVITVDRHGNTSAASVPLALTMAICDGKI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 301 KKGDLVMLEAMGGGFTWGAILIRW 324


>gi|319898985|ref|YP_004159078.1| acyl-carrier-protein [Bartonella clarridgeiae 73]
 gi|319402949|emb|CBI76500.1| acyl-carrier-protein [Bartonella clarridgeiae 73]
          Length = 323

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 252/324 (77%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS + G+G +LP++ LSN ++  +V+TSD WI +R GI +RHIA  +ETT SLG  AA
Sbjct: 1   MIRSVICGVGSALPKKSLSNDEIAELVETSDSWIVQRTGIRQRHIADDNETTVSLGIKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +  M+V DID II+ATSTP++TFP++AV IQ  LGM+ GFAFD+QAVCSGF++A+
Sbjct: 61  QAALANTGMTVKDIDCIILATSTPNRTFPASAVEIQRALGMRHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            T D+Y+R G  +R++VIGSDTFSRI+DW DR+TCVLFGDG+GA ILE  E +G+S AD 
Sbjct: 121 VTGDAYLRCGAAKRILVIGSDTFSRILDWQDRTTCVLFGDGSGAAILEAQEFEGTS-ADY 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L SDG Y DKLYVDGGPST++T G +RMEG+ VFK+AV    ++++  F +  +
Sbjct: 180 GILSAKLRSDGEYADKLYVDGGPSTTQTTGYLRMEGREVFKHAVGMITDVVDNCFAAVEM 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  D++I+T+D HGNTSAAS+PLALA AV++GR+
Sbjct: 240 KPSQLDWFVPHQANKRIIEASAKKLGIAKDRIIITIDQHGNTSAASVPLALATAVQDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 300 KKGDLIMLEAMGGGFTWGAILIRW 323


>gi|319404310|emb|CBI77903.1| acyl-carrier-protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 323

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 256/324 (79%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS +  +G +LP++ +SN ++  +V+TSD WI +R GI +R+IA  +ETT SLG  AA
Sbjct: 1   MIRSVLCSVGSALPKKNVSNDEITKLVETSDSWIVQRTGIRQRYIADSNETTVSLGVQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           +DAL +A M+V DID II+ATSTP++TFP++AV IQ+ LGMK GFAFD+QAVCSGF++A+
Sbjct: 61  QDALKNAGMTVKDIDCIILATSTPNRTFPASAVEIQHALGMKHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            T D+Y+R GV +R++VIGSDTFSRI+DW DR+TCVLFGDG+GA ILE  E +G+S AD+
Sbjct: 121 VTGDAYLRCGVAKRILVIGSDTFSRILDWQDRTTCVLFGDGSGAAILEAQEFEGTS-ADS 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L SDG Y+DKLYVDGGPST++T G +RM+G+ VFK+AV    ++++  F +  +
Sbjct: 180 GILSAKLRSDGEYVDKLYVDGGPSTTQTTGYLRMDGREVFKHAVSMITDVVDDCFAAVGM 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  D++++T+D HGNTSA S+PLALA AV++GR+
Sbjct: 240 KPSQLDWFVPHQANRRIIEASAKKLGITKDQIVITIDQHGNTSAGSVPLALATAVQDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 300 KKGDLIMLEAMGGGFTWGAILIRW 323


>gi|319407315|emb|CBI80956.1| acyl-carrier-protein [Bartonella sp. 1-1C]
          Length = 323

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 256/324 (79%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS V  +G +LP++ +SN ++  +V+TSD WI +R GI +R+IA  +ETT SLG  AA
Sbjct: 1   MIRSVVCSVGSALPKKNVSNDEITKLVETSDSWIVQRTGIRQRYIADSNETTVSLGVQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++AL +A M+V DID II+ATSTP++TFP++AV IQ+ LGMK GFAFD+QAVCSGF++A+
Sbjct: 61  QEALKNAGMTVKDIDCIILATSTPNRTFPASAVEIQHALGMKHGFAFDIQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            T D+Y+R GV +R++VIGSDTFSRI+DW DR+TCVLFGDG+GA ILE  E +G+S +D+
Sbjct: 121 VTGDAYLRCGVAKRILVIGSDTFSRILDWQDRTTCVLFGDGSGAAILEAQEFEGTS-SDS 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L SDG Y+DKLYVDGGPST++T G +RM+G+ VFK+AV    ++++  F +  +
Sbjct: 180 GILSAKLRSDGEYVDKLYVDGGPSTTQTTGYLRMDGREVFKHAVSMITDVVDDCFAAVGM 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  D++++T+D HGNTSA S+PLALA AV++GR+
Sbjct: 240 NPSQLDWFVPHQANRRIIEASAKKLGIIKDQIVITIDQHGNTSAGSVPLALATAVQDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 300 KKGDLIMLEAMGGGFTWGAILIRW 323


>gi|319405753|emb|CBI79376.1| acyl-carrier-protein [Bartonella sp. AR 15-3]
          Length = 323

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 187/324 (57%), Positives = 256/324 (79%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS +  +G +LP++ LSN ++   V+TSD WI +R GI +R+IA  +ETT SLG  AA
Sbjct: 1   MIRSVMCSVGSALPKKSLSNDEITKFVETSDSWIVQRTGIRQRYIADNNETTVSLGIKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++AL ++ M+V DID II+ATSTP++TFP++AV IQ+ LGMK GFAFD+QAVCSGF++A+
Sbjct: 61  QEALKNSGMTVKDIDCIILATSTPNRTFPASAVEIQHALGMKHGFAFDVQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            T D+Y+R GV +R++VIGSDTFSRI+DW+DR+TCVLFGDG+GA ILE  E +G + AD+
Sbjct: 121 VTGDAYLRCGVAKRILVIGSDTFSRILDWTDRTTCVLFGDGSGAAILEAQEFEG-TFADS 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILS  L SDG+Y DKLYVDGGPST++T G +RM+G+ VFK+AV    ++++  F +  +
Sbjct: 180 GILSAKLRSDGAYADKLYVDGGPSTTQTTGYLRMDGREVFKHAVSMITDVVDDCFAAVEM 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  D++++T+D HGNTSAAS+PLALA A+++GR+
Sbjct: 240 KPSQLDWFVPHQANKRIIEASARKLGITKDRIVITIDQHGNTSAASVPLALATAIQDGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD ++LEAMGGGFT G +L+RW
Sbjct: 300 KKGDLIMLEAMGGGFTWGAILIRW 323


>gi|121602417|ref|YP_988942.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bartonella
           bacilliformis KC583]
 gi|254783784|sp|A1USI9|FABH_BARBK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120614594|gb|ABM45195.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Bartonella
           bacilliformis KC583]
          Length = 324

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/324 (59%), Positives = 255/324 (78%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS + G+G +LP++ LSN ++   V+TSD WI +R GI +R+IA ++ETT SLG  AA
Sbjct: 1   MIRSVMCGVGSALPKKKLSNDEIAKFVETSDSWIVQRTGIHQRYIASENETTVSLGIEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A M++ DID II+ATSTP++TFPS+AV IQ+ LGM  GF+FD+QAVCSGF++A+
Sbjct: 61  QVALTNAGMTIKDIDCIILATSTPNRTFPSSAVEIQHALGMSHGFSFDVQAVCSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T  D Y+RSG  +RV+VIGS+TFSRI+DW DR+TCVLFGDGAGA ILE  EV+G+   D 
Sbjct: 121 TIGDVYLRSGEAKRVLVIGSETFSRILDWKDRTTCVLFGDGAGAAILEAREVEGNVAIDR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST L S+G++IDKLY DGGPST++T+G +RM+G+ VFK+AV    ++I+  F +  +
Sbjct: 181 GILSTKLRSNGAHIDKLYADGGPSTTQTIGYLRMKGQEVFKHAVGIVTDVIDDCFAAVGM 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               +DWFVPHQAN RII +   K+ I  DKV++TVD HGNTSAAS+PLALA AV++GR+
Sbjct: 241 NPSQLDWFVPHQANKRIIEASAKKLGIKTDKVVITVDQHGNTSAASVPLALATAVQDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +LLEAMGGGFT G VL+RW
Sbjct: 301 KEGDLVLLEAMGGGFTWGAVLIRW 324


>gi|254500527|ref|ZP_05112678.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Labrenzia alexandrii
           DFL-11]
 gi|222436598|gb|EEE43277.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Labrenzia alexandrii
           DFL-11]
          Length = 311

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 250/312 (80%), Gaps = 1/312 (0%)

Query: 13  LPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVD 72
           +P ++L+NSDL  +VDTSD WI +R GI +RH+A + + T+ L   AA  AL  A    D
Sbjct: 1   MPEKILTNSDLAKMVDTSDDWIVQRTGIQQRHVAAEGQVTSDLAVEAALRALESAGRKAD 60

Query: 73  DIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVV 132
           DID II+AT+TPD TFP+T+V++Q RLG+  GFAFD+ AVCSGFVYA+TTAD+YIRSG+ 
Sbjct: 61  DIDTIILATATPDNTFPATSVSVQARLGINHGFAFDVHAVCSGFVYALTTADAYIRSGMS 120

Query: 133 RRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGS 192
           +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA+++E  E +G++ AD G+L+++L SDG 
Sbjct: 121 KRCLVIGAETFSRILDWNDRTTCVLFGDGAGAVVVEASEGEGNT-ADKGVLTSHLRSDGR 179

Query: 193 YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQ 252
           + DKL+VDGGPS+++TVG +RMEGK VFK+AV    ++IE  + +T LT E++ WF+PHQ
Sbjct: 180 HKDKLFVDGGPSSTQTVGYLRMEGKEVFKHAVGMITDVIEDAYSATGLTSEDLTWFIPHQ 239

Query: 253 ANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMG 312
           AN RII++   K+KI  +KV+ TV +HGNTSAASIPLAL +AV++GRVKK D ++LEAMG
Sbjct: 240 ANKRIIDASAKKLKIAPEKVVTTVQMHGNTSAASIPLALDLAVRDGRVKKDDLIMLEAMG 299

Query: 313 GGFTSGTVLLRW 324
           GGFT G+VLLRW
Sbjct: 300 GGFTWGSVLLRW 311


>gi|306841979|ref|ZP_07474653.1| 3-oxoacyl-acyl-carrier-protein synthase III [Brucella sp. BO2]
 gi|306287907|gb|EFM59324.1| 3-oxoacyl-acyl-carrier-protein synthase III [Brucella sp. BO2]
          Length = 306

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/307 (62%), Positives = 247/307 (80%), Gaps = 1/307 (0%)

Query: 18  LSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLI 77
           + N+D + IV+TSD WI +R GI  RHIAG+ ETT SLG AAAR A+ +A +   DIDL+
Sbjct: 1   MKNTDFKGIVETSDEWIVQRTGIRERHIAGEGETTVSLGAAAARAAIENAGLQPSDIDLV 60

Query: 78  IVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMV 137
           ++ATSTP+ TFP++AV IQ  LG+ RGFAFD+QAVCSGF+YA+TTAD YIR G+ RRV+V
Sbjct: 61  LLATSTPNNTFPASAVAIQRELGITRGFAFDLQAVCSGFIYAITTADLYIRGGMARRVLV 120

Query: 138 IGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKL 197
           IG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G + +D GIL+  L SDG++ +KL
Sbjct: 121 IGAETFSRILDWTDRTTCVLFGDGAGAIVLEAAEGHGLT-SDRGILAANLRSDGNHKEKL 179

Query: 198 YVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRI 257
           YVDGGPST++TVG +RMEG+ VFK+AV    ++IE  F++T LT E+IDWFVPHQAN RI
Sbjct: 180 YVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIEASFEATGLTAEDIDWFVPHQANKRI 239

Query: 258 INSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTS 317
           I++   K+ I  +KV++TVD HGNTSAAS+PLALA A  +GR+KKGD +LLEAMGGGFT 
Sbjct: 240 IDASAKKLHIAEEKVVITVDRHGNTSAASVPLALATAAADGRIKKGDLVLLEAMGGGFTW 299

Query: 318 GTVLLRW 324
           G VL+RW
Sbjct: 300 GAVLVRW 306


>gi|316934098|ref|YP_004109080.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodopseudomonas
           palustris DX-1]
 gi|315601812|gb|ADU44347.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodopseudomonas
           palustris DX-1]
          Length = 325

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 246/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRS V G G  LP RVL+N +L   VDTSD WI +R GI  RHIA   E T+ L   AA
Sbjct: 3   VIRSVVLGCGAYLPERVLTNEELARTVDTSDEWIVQRTGIRERHIAADGEFTSHLATKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A ++ D IDLI++ATSTPD TFP+TAV +Q  LGM  G AFD+QAVCSGFV+AV
Sbjct: 63  QAALDNAGLTADQIDLIVLATSTPDHTFPATAVQVQAALGMTHGVAFDLQAVCSGFVFAV 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+Y+R+G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E  G+S AD 
Sbjct: 123 ATADNYLRAGSAKRALVIGAETFSRILDWNDRGTCVLFGDGAGAIVLEAQEGWGTS-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG +  KLYVDGGPS+++TVG +RMEG+ VFK+AV     +I   F+++  
Sbjct: 182 GVLTTHLRSDGRHKHKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITGVIVDAFNASGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +N+DWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL  AV++GR+
Sbjct: 242 SADNVDWFVPHQANKRIIDASAQKLHIAPEKVVMTVDRHGNTSAASIPLALCTAVQDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KG  +LLEAMGGGFT G  LLRW
Sbjct: 302 QKGHLVLLEAMGGGFTWGAALLRW 325


>gi|90419420|ref|ZP_01227330.1| beta-ketoacyl- acyl carrier protein synthase III [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336357|gb|EAS50098.1| beta-ketoacyl- acyl carrier protein synthase III [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 328

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 248/324 (76%), Gaps = 1/324 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS +RG G  LP R + N D   IV+TSD WI++R GI  RHIAG+ ETT SL E AAR
Sbjct: 5   IRSVIRGTGSVLPARTMRNQDFAGIVETSDEWIRQRTGIEARHIAGEGETTVSLAEGAAR 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++  DID+II+AT+TP+ TFP++AV +Q++LG+  GFAFD+ AVCSGFVYA+T
Sbjct: 65  KALDAAGLTPADIDVIILATATPNNTFPASAVQVQHKLGITHGFAFDVHAVCSGFVYALT 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEV-KGSSMADT 180
           TAD Y++ G  +R +VIG++TFSRI+DW DRSTCVLFGDGAGA++LE V   +  + A  
Sbjct: 125 TADLYLKGGAAKRALVIGAETFSRILDWEDRSTCVLFGDGAGAVVLEAVPADEADAGAAQ 184

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+++ L SDGS+  KLYVDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F +  +
Sbjct: 185 GIITSKLRSDGSHQGKLYVDGGPSTTGTVGKLRMEGREVFKHAVGMITDVIEDSFAAAGI 244

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
             +++DWFVPHQAN RII++   K+ I  +KV++TV+ HGNTSAASIPLAL  AV++GR+
Sbjct: 245 GPDDVDWFVPHQANRRIIDASARKLGIAPEKVVITVNQHGNTSAASIPLALDAAVRDGRI 304

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +LLEAMGGGFT G VL+RW
Sbjct: 305 KRGDLVLLEAMGGGFTWGAVLIRW 328


>gi|86749767|ref|YP_486263.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris HaA2]
 gi|86572795|gb|ABD07352.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodopseudomonas
           palustris HaA2]
          Length = 325

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 247/324 (76%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G G  LP R+L+N++L + VDTSD WI +R GI  RHIA + E T+ L   AA
Sbjct: 3   VVRSVVLGCGAYLPERILTNAELAATVDTSDEWIVQRTGIRERHIAAEGEYTSHLATKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A ++ D IDLI++ATSTPD TFP+TAV +Q  LGM  G AFD+QAVCSGFV+AV
Sbjct: 63  QAALDDAGLTADQIDLIVLATSTPDHTFPATAVQVQAALGMTHGVAFDLQAVCSGFVFAV 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+++R G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E  G+S AD 
Sbjct: 123 ATADNFLRGGSAKRALVIGAETFSRILDWNDRGTCVLFGDGAGAIVLEAQEGWGTS-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG +  KLYVDGGPS+++TVG +RMEG+ VFK+AV     +I   F+++  
Sbjct: 182 GVLTTHLRSDGRHKHKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITGVIIDAFNASGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +N+DWFVPHQAN RII++   K+ I   KV++TVD HGNTSAASIPLALA AV +GR+
Sbjct: 242 SADNVDWFVPHQANKRIIDASAQKLHIAPQKVVMTVDRHGNTSAASIPLALAAAVADGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KG  +LLEAMGGGFT G+ LLRW
Sbjct: 302 QKGHLVLLEAMGGGFTWGSALLRW 325


>gi|114704823|ref|ZP_01437731.1| 3-oxoacyl-(acyl carrier protein) synthase [Fulvimarina pelagi
           HTCC2506]
 gi|114539608|gb|EAU42728.1| 3-oxoacyl-(acyl carrier protein) synthase [Fulvimarina pelagi
           HTCC2506]
          Length = 323

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 254/323 (78%), Gaps = 4/323 (1%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G +LP RV++N D + +V+TSD WI++R GI+ RHIAG+ ETT SLGEAAAR
Sbjct: 5   IRSIVLGTGSALPERVMTNRDFDGVVETSDEWIRQRTGIAERHIAGEGETTVSLGEAAAR 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DIDLI++AT+TPD TFP++AV +QNRLG+  GFAFD+ AVC+GFVYA+T
Sbjct: 65  RALDAASLQPADIDLIVLATATPDHTFPASAVQVQNRLGIHHGFAFDVHAVCTGFVYALT 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD Y+RSG+ +R +VIG++TFSRI+DWSDR+TCVLFGDGAGA++LE  + +G    D G
Sbjct: 125 TADLYLRSGLAKRALVIGAETFSRILDWSDRTTCVLFGDGAGAIVLEARKEEG----DRG 180

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L + L SDG + +KL+VDGGPST+ TVG +RMEG+ VF++AV    ++IE  F  +  +
Sbjct: 181 VLVSKLRSDGVHKEKLFVDGGPSTTGTVGHLRMEGREVFRHAVGMITDVIEDSFAESGFS 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E+IDWFVPHQAN RII++   K+ IP +KV+VTV+ HGNTSAASIPLAL +A ++GR++
Sbjct: 241 AEDIDWFVPHQANRRIIDASAKKLGIPSEKVVVTVEKHGNTSAASIPLALDIAARDGRIQ 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  +LLEAMGGGFT G  L+RW
Sbjct: 301 RGQLVLLEAMGGGFTWGACLIRW 323


>gi|39935808|ref|NP_948084.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris CGA009]
 gi|192291396|ref|YP_001992001.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris TIE-1]
 gi|39649661|emb|CAE28183.1| 3-oxoacyl-acyl carrier protein synthase III [Rhodopseudomonas
           palustris CGA009]
 gi|192285145|gb|ACF01526.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodopseudomonas
           palustris TIE-1]
          Length = 325

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 244/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRS V G G  LP RVL+N +L   VDTSD WI +R GI  RHIA   E T+ L   AA
Sbjct: 3   VIRSVVLGCGAYLPERVLTNEELARTVDTSDEWIVQRTGIRERHIAADGEFTSHLATKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A ++ D IDLI++ATSTPD TFP+TAV +Q  LGM  G AFD+QAVCSGFV+AV
Sbjct: 63  QAALDNAGITADQIDLIVLATSTPDHTFPATAVQVQAALGMTHGVAFDLQAVCSGFVFAV 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+Y+R+G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E   S+ AD 
Sbjct: 123 ATADNYLRAGSAKRALVIGAETFSRILDWNDRGTCVLFGDGAGAIVLEAQE-GWSTSADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG +  KLYVDGGPS+++TVG +RMEG+ VFK+AV     +I   F+++  
Sbjct: 182 GVLTTHLRSDGRHKHKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITGVIVDAFNASGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +N+DWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL  AV +GR+
Sbjct: 242 SADNVDWFVPHQANKRIIDASAQKLHIAPEKVVMTVDRHGNTSAASIPLALCTAVADGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KG  +LLEAMGGGFT G  LLRW
Sbjct: 302 QKGHLVLLEAMGGGFTWGAALLRW 325


>gi|118587999|ref|ZP_01545409.1| 3-oxoacyl-(acyl carrier protein) synthase [Stappia aggregata IAM
           12614]
 gi|118439621|gb|EAV46252.1| 3-oxoacyl-(acyl carrier protein) synthase [Stappia aggregata IAM
           12614]
          Length = 325

 Score =  387 bits (995), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 253/324 (78%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRSTV G G  LP ++L+N DL  +VDTSD WI +R GI +RH+AG+ + T+ L   AA
Sbjct: 3   VIRSTVTGCGSFLPEKILTNDDLSKMVDTSDEWIVQRTGIQQRHVAGEGQVTSDLALEAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A     +ID II+AT+TPD TFP+TAV +Q  LG+  G AFD+ AVCSGFVYA+
Sbjct: 63  RRALESAGRDAQEIDTIILATATPDNTFPATAVTVQANLGIYHGAAFDVHAVCSGFVYAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+YIR+G+ +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA+++E  E +G++ AD 
Sbjct: 123 TTADAYIRAGLSKRCLVIGAETFSRILDWTDRTTCVLFGDGAGAVVVEAGEGEGTT-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+++L SDG + +KL+VDGGPS+++TVG +RMEG+ V+K+AV    ++IE  + +T  
Sbjct: 182 GVLTSHLRSDGRHKEKLFVDGGPSSTQTVGHLRMEGREVYKHAVGMITDVIEDAYKATGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DWF+PHQAN RII++   K+ I  +KV+ TV +HGNTSAASIPLAL  AV++GRV
Sbjct: 242 TSDDLDWFIPHQANKRIIDASAKKLGIAPEKVVTTVQLHGNTSAASIPLALDTAVRDGRV 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KK D ++LEAMGGGFT G+VLLRW
Sbjct: 302 KKNDLVMLEAMGGGFTWGSVLLRW 325


>gi|91977157|ref|YP_569816.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris BisB5]
 gi|91683613|gb|ABE39915.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodopseudomonas
           palustris BisB5]
          Length = 325

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 246/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+RS V G G  LP +VL+N++L + VDTSD WI +R GI  RHIA + E T+ L   AA
Sbjct: 3   MVRSVVLGCGSYLPEKVLTNAELAAKVDTSDEWIVQRTGIRERHIAAEGEYTSHLAIKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +    IDLI++ATSTPD TFP+TAV +Q  LG+  G AFD+QAVCSGFV+AV
Sbjct: 63  QAALENAGIDAQSIDLIVLATSTPDNTFPATAVAVQAALGIHHGVAFDLQAVCSGFVFAV 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+++R+G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E  G+S AD 
Sbjct: 123 ATADNFLRAGSAKRALVIGAETFSRIIDWNDRGTCVLFGDGAGAIVLEAQEGWGTS-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG +  KLYVDGGPST++TVG +RMEG+ VFK+AV     +I   F+++  
Sbjct: 182 GVLTTHLRSDGRHKHKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITGVIIDAFNASGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +N+DWFVPHQAN RII++   K+ I   KV++TVD HGNTSAASIPLALA AV +GR+
Sbjct: 242 SADNVDWFVPHQANKRIIDASAQKLHIAPQKVVMTVDRHGNTSAASIPLALAAAVADGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KG  +LLEAMGGGFT G  LLRW
Sbjct: 302 QKGHLVLLEAMGGGFTWGAALLRW 325


>gi|254469167|ref|ZP_05082572.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pseudovibrio sp.
           JE062]
 gi|211961002|gb|EEA96197.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pseudovibrio sp.
           JE062]
          Length = 325

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 243/323 (75%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS   G G  LP + L+N  L  IVDTSD WI +R GI  RHIA + E T+ L   AA+
Sbjct: 4   LRSVFLGCGSYLPEKALTNQQLTEIVDTSDEWIVQRTGIKNRHIAAEGEFTSHLAVNAAK 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL +A +   DIDLI++ATSTPD TFP+TAV +Q  LG+  GFAFD+QAVCSGFVYAVT
Sbjct: 64  AALENAGVDAQDIDLIVLATSTPDNTFPATAVAVQAALGINHGFAFDVQAVCSGFVYAVT 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+Y+R G+ +R +VIG++TFSRI+DW DR+TCVLFGDGAGA+++E  E +  S+ ++G
Sbjct: 124 TADAYLRGGLAKRALVIGAETFSRILDWEDRTTCVLFGDGAGAVVMEAQEGE-PSIDESG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+  L SDG + +KLYVDGGPST+ T G +RM+GK VFK+AV    ++IE  FD+T  +
Sbjct: 183 VLTCQLRSDGRHKEKLYVDGGPSTTGTAGHLRMQGKEVFKHAVGMVTDVIEAAFDATGTS 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DWFVPHQAN RII++   K+ I  +KV+ TV  HGNTSAASIPLAL   VK G+VK
Sbjct: 243 AEDLDWFVPHQANQRIIDASAKKLGIAPEKVVKTVSQHGNTSAASIPLALDSIVKAGKVK 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD ++LEAMGGGFT G+VLL+W
Sbjct: 303 KGDLIMLEAMGGGFTWGSVLLKW 325


>gi|27380131|ref|NP_771660.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bradyrhizobium
           japonicum USDA 110]
 gi|34098507|sp|Q89K89|FABH_BRAJA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|27353285|dbj|BAC50285.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Bradyrhizobium
           japonicum USDA 110]
          Length = 326

 Score =  384 bits (987), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 248/323 (76%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G  LP +V++N+ L + +DTSD WI +R GI  RHIA + E T+ L   AA+
Sbjct: 4   IRSVVLGCGSYLPEQVVTNAQLAARIDTSDEWIVQRTGIRERHIAAEGEFTSHLAIKAAQ 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    IDLI++ATSTPD TFP+TAV +Q+ LG+  G AFD+QAVCSGFV+A+ 
Sbjct: 64  AALTDAGVDAQSIDLIVLATSTPDNTFPATAVAVQHGLGINHGAAFDLQAVCSGFVFALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+++R+G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E  GS+  D G
Sbjct: 124 TADNFLRTGAFKRALVIGAETFSRILDWNDRGTCVLFGDGAGAVVLEAQEQPGSAATDRG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +++T+L SDG +  KL+VDGGPS+++TVG +RMEG+ VFK+AV    ++I   F++T L 
Sbjct: 184 VVTTHLRSDGRHKAKLFVDGGPSSTQTVGHLRMEGREVFKHAVGMITDVIVDAFEATGLN 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            ++IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLALAVA K+GR+K
Sbjct: 244 ADSIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALAVARKDGRIK 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +LLEAMGGGFT G+ L+RW
Sbjct: 304 RGDLILLEAMGGGFTWGSALVRW 326


>gi|307945253|ref|ZP_07660589.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Roseibium sp.
           TrichSKD4]
 gi|307771126|gb|EFO30351.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Roseibium sp.
           TrichSKD4]
          Length = 325

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 253/324 (78%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRSTV G G  LP +VL+N DL  +VDTSD WI +R GI +RHIA + E T+ L   AA
Sbjct: 3   VIRSTVLGCGSYLPEKVLTNQDLAKLVDTSDEWIVQRTGIQQRHIAAEGEVTSDLATNAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL HA +   DID II+AT+TPD TFPS+AV +Q +LG+  G AFD+ AVCSGFVYA+
Sbjct: 63  KAALAHAGIDAQDIDTIILATATPDNTFPSSAVTVQEKLGITHGAAFDVHAVCSGFVYAM 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD+Y+++G+ +R +VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  E +G ++AD 
Sbjct: 123 TTADAYLKTGLSKRCLVIGAETFSRILDWEDRTTCVLFGDGAGAVVLEAQEGEG-TVADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+++L SDG + DKLYVDGGPS ++TVG +RMEG+ VFK+AV    ++IE  + +T  
Sbjct: 182 GVLTSHLRSDGRHKDKLYVDGGPSGTQTVGHLRMEGREVFKHAVGMITDVIEDAYVATGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T +++DWFVPHQAN RII++   K+ I  +KV+ TV +HGNTSA SIPLAL  AVK+GR+
Sbjct: 242 TSDDLDWFVPHQANKRIIDASAKKLGIALEKVVATVQMHGNTSAGSIPLALDTAVKDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           +KGD ++LEAMGGGFT G+VLLRW
Sbjct: 302 QKGDLIMLEAMGGGFTWGSVLLRW 325


>gi|114771804|ref|ZP_01449197.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [alpha
           proteobacterium HTCC2255]
 gi|114547620|gb|EAU50511.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [alpha
           proteobacterium HTCC2255]
          Length = 325

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/323 (57%), Positives = 238/323 (73%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+   G+G  LP+R+++NS+L   VDTSD WIK R GI RRH A  DE T+ L   AA 
Sbjct: 4   IRAVPIGVGHFLPKRIVTNSELAKTVDTSDEWIKTRTGIERRHFAADDEFTSDLAIKAAM 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +AL +A +S +DID I++ATSTPDQTFPSTA  +Q  LGM  GFAFD+QAVC+GF YA+T
Sbjct: 64  NALKNANISANDIDTIVLATSTPDQTFPSTATKVQTGLGMTSGFAFDVQAVCAGFAYALT 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+S I SG  ++++VIG++TFSRI+DW DR+TCVLFGDGAGALILE  E +G+S  D G
Sbjct: 124 IANSLIVSGQSKKILVIGAETFSRIMDWEDRTTCVLFGDGAGALILEAQECEGTSQ-DRG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS  L SDG Y D LYVDGG ST++T G +RM+G+ VFK+AV K  E  E       +T
Sbjct: 183 ILSCDLSSDGKYNDLLYVDGGVSTTQTTGVLRMQGQEVFKHAVGKLAESGENAMSKAGIT 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DW VPHQAN RII S   KM +P +KV++TV  HGNTSAASIPLAL+VAV++G++K
Sbjct: 243 SEDVDWIVPHQANLRIIKSTAKKMAVPMEKVVLTVQDHGNTSAASIPLALSVAVEKGQIK 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           + + +L EA+GGG   G V+ RW
Sbjct: 303 RNNLILTEAIGGGLAWGAVVFRW 325


>gi|115524832|ref|YP_781743.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris BisA53]
 gi|115518779|gb|ABJ06763.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodopseudomonas
           palustris BisA53]
          Length = 325

 Score =  382 bits (982), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 246/322 (76%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G G  LP R+L+N++L + VDTSD WI +R GI +RHIA + E T+ L   AA+ 
Sbjct: 5   RSVVLGCGSYLPERILTNAELAAKVDTSDEWIVQRTGIRQRHIAAEGEFTSHLAIKAAQA 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A +    IDLI++ATSTPD TFP+TAV +Q  LG+  G AFD+QAVCSGFV+A+ T
Sbjct: 65  ALDNAGIDAQSIDLIVLATSTPDHTFPATAVQVQAALGINHGVAFDLQAVCSGFVFALAT 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+++R G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  E  G+S AD G+
Sbjct: 125 ADNFLRCGSAKRALVIGAETFSRILDWNDRGTCVLFGDGAGAVVLEAQENWGTS-ADHGV 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T+L SDG +  KLYVDGGPS+++TVG +RMEGK VFK+AV     +I   F+++  T 
Sbjct: 184 LTTHLRSDGRHKSKLYVDGGPSSTQTVGHLRMEGKEVFKHAVSMITGVIIDAFEASGTTA 243

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++I+WFVPHQAN RII++   K+ +  +KV++TVDIHGNTSAASIPLAL+ AV +GR+K+
Sbjct: 244 KDINWFVPHQANKRIIDASAHKLHLAPEKVVLTVDIHGNTSAASIPLALSTAVADGRIKR 303

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD +L EAMGGGFT G  L+RW
Sbjct: 304 GDLVLFEAMGGGFTWGAALVRW 325


>gi|328543548|ref|YP_004303657.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [polymorphum gilvum
           SL003B-26A1]
 gi|326413292|gb|ADZ70355.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Polymorphum gilvum
           SL003B-26A1]
          Length = 325

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 246/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRSTV G G  LP + L+N DL  +VDT+D WI +R GI +RHIA   E T+ L   AA
Sbjct: 3   VIRSTVLGCGSYLPEKCLTNDDLARMVDTTDEWIVQRTGIRQRHIAADGEFTSHLAIKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL HA +   DID II+AT+TPD TFP+TAV++Q  LG+  G AFD+ AVCSGFVYA+
Sbjct: 63  QRALRHAGVDAQDIDTIILATATPDNTFPATAVSVQADLGIYHGMAFDIHAVCSGFVYAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+++R G  +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G ++ D 
Sbjct: 123 ATADAFMRCGQSKRALVIGAETFSRILDWNDRTTCVLFGDGAGAVVLEAREGSG-TLGDR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG    KLYVDGGPS+++TVG +RMEG+ VFK+AV    ++IE  F +T  
Sbjct: 182 GVLTTHLRSDGRNKCKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITDVIEDAFAATGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + +++DWFVPHQAN RII++   K+ I  +KV+ TVD+HGNTSAASIPLAL  AV++GRV
Sbjct: 242 SADDLDWFVPHQANKRIIDASAKKLGIAPEKVVTTVDLHGNTSAASIPLALDSAVRDGRV 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K GD +LLEAMGGGFT G+ LLRW
Sbjct: 302 KTGDLVLLEAMGGGFTWGSALLRW 325


>gi|323137736|ref|ZP_08072812.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylocystis sp.
           ATCC 49242]
 gi|322397033|gb|EFX99558.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylocystis sp.
           ATCC 49242]
          Length = 329

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 244/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
             RS V G+G  LP + L+N +L  +VDTSD WI +R GI  RHIA K ETT+ LGE AA
Sbjct: 7   QFRSVVLGVGSYLPEKTLTNDELAKLVDTSDEWIVQRTGIKERHIAAKGETTSMLGEKAA 66

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL +A +  DDIDLIIV TSTPD TFPSTA  IQ  LG+  G AFD+QAVCSGFV+AV
Sbjct: 67  RAALANAGLQPDDIDLIIVGTSTPDWTFPSTATQIQAALGITHGVAFDLQAVCSGFVFAV 126

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD ++RSG  +R +V+G++TFSRI+DW DR+TCVLFGDGAGA++LE     G S+ + 
Sbjct: 127 ATADKFLRSGSHKRALVVGAETFSRIIDWEDRTTCVLFGDGAGAMVLEARASTG-SLDER 185

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG +  KL+VDGGPS ++TVG +RMEGK VFK+AV K  +++   F +T +
Sbjct: 186 GVLTTHLRSDGRHRAKLHVDGGPSATQTVGHLRMEGKEVFKFAVGKVTDVVADAFAATGI 245

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E +DWFVPHQAN RII+    K+ I  +KVI TV +HGNTSAAS+PLAL+VA  +GR+
Sbjct: 246 TPEQLDWFVPHQANRRIIDMSAQKLGIAPEKVIATVHLHGNTSAASVPLALSVAAADGRI 305

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEA+GGGFT G+ L+RW
Sbjct: 306 KQGDLVMLEAVGGGFTWGSALIRW 329


>gi|146341333|ref|YP_001206381.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bradyrhizobium sp.
           ORS278]
 gi|166233360|sp|A4YW84|FABH_BRASO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|146194139|emb|CAL78160.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III)(KAS III) [Bradyrhizobium sp. ORS278]
          Length = 324

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 252/323 (78%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G  LP+RV++N++L S ++TSD WI +R GI  RH+A   E T+ L   AAR
Sbjct: 3   IRSVVLGCGSYLPQRVVTNAELASRIETSDEWIVQRTGIRERHVAADGEFTSHLAINAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL +A++    IDLI++ TSTPD TFP+TAV +QN LG+  G AFD+QAVCSGFVYA+ 
Sbjct: 63  AALANADVDPQSIDLIVLGTSTPDNTFPATAVAVQNGLGIHHGAAFDLQAVCSGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+++RSG  +R +VIG++TFSRI+DW+DR+TCVLFGDGAGAL+L+  + +G + AD G
Sbjct: 123 TADNFLRSGSFKRALVIGAETFSRILDWNDRTTCVLFGDGAGALVLD-AQQQGGTAADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LST+L SDG +  KLYVDGGPS+++TVG +RMEG+ VFK+AV    ++I   F++T L+
Sbjct: 182 VLSTHLRSDGRHKAKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITDVIVDAFEATGLS 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL VAVK+GR+K
Sbjct: 242 AETIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALDVAVKDGRIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD +LLEAMGGGFT G+ L+RW
Sbjct: 302 KGDVVLLEAMGGGFTWGSALVRW 324


>gi|75675599|ref|YP_318020.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrobacter
           winogradskyi Nb-255]
 gi|74420469|gb|ABA04668.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrobacter
           winogradskyi Nb-255]
          Length = 325

 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/323 (59%), Positives = 248/323 (76%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G  LP+RVL+NS+L + VDTSD WI +R GI +RHIA + E T+ L   AA 
Sbjct: 4   IRSVVLGCGSYLPQRVLTNSELATKVDTSDEWIVQRTGIRQRHIAAEGEFTSHLAIHAAN 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL HA +    IDLI+VATSTPD TFP+TAV +QN LG+  G AFD+QAVCSGFV+A+ 
Sbjct: 64  AALAHAGIDAQSIDLIVVATSTPDHTFPATAVAVQNGLGIHHGAAFDLQAVCSGFVFALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+++RSG  +R +VIG++TFSRI+DW+DRSTCVLFGDGAGA++LE  E  G+ + D G
Sbjct: 124 TADNFLRSGAFKRALVIGAETFSRILDWTDRSTCVLFGDGAGAVVLEAQEQPGTPL-DRG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T+L SDG +  KLYVDGGPS++RTVG +RMEG+ VFK+AV    ++I   F+++   
Sbjct: 183 ILTTHLRSDGRHQSKLYVDGGPSSTRTVGHLRMEGREVFKHAVGMITDVIVDAFNASGTN 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +I WFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL+VAV +GR+K
Sbjct: 243 ANDIKWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALSVAVADGRIK 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD +LLEAMGGGFT G+ L+RW
Sbjct: 303 SGDLVLLEAMGGGFTWGSALVRW 325


>gi|148255980|ref|YP_001240565.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bradyrhizobium sp.
           BTAi1]
 gi|166233359|sp|A5EKG5|FABH_BRASB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|146408153|gb|ABQ36659.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Bradyrhizobium sp.
           BTAi1]
          Length = 324

 Score =  377 bits (969), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 251/323 (77%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G  LP+RV++N++L S ++TSD WI +R GI  RH+A + E T+ L   AAR
Sbjct: 3   IRSVVLGCGSYLPQRVVTNAELASRIETSDDWIVQRTGIRERHVAAEGEFTSHLAINAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A++    IDLI++ TSTPD TFP+TAV +Q+ LG+  G AFD+QAVCSGFVYA+ 
Sbjct: 63  AALAAADVDPQSIDLIVLGTSTPDNTFPATAVAVQDGLGIHHGAAFDLQAVCSGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+++RSG  +R +VIG++TFSRI+DW+DR+TCVLFGDGAGAL+L+     G+S AD G
Sbjct: 123 TADNFLRSGSFKRALVIGAETFSRILDWNDRTTCVLFGDGAGALVLDAQRQDGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+T+L SDG +  KLYVDGGPS+++TVG +RMEG+ VFK+AV    ++I   F++T L+
Sbjct: 182 VLTTHLRSDGRHKAKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITDVIVDAFEATGLS 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL VAVK+GR+K
Sbjct: 242 AETIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALDVAVKDGRIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD +LLEAMGGGFT G+ L+RW
Sbjct: 302 KGDVVLLEAMGGGFTWGSALVRW 324


>gi|209885009|ref|YP_002288866.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Oligotropha
           carboxidovorans OM5]
 gi|209873205|gb|ACI93001.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Oligotropha
           carboxidovorans OM5]
          Length = 325

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/324 (57%), Positives = 250/324 (77%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G G  LP RV++N++L  +VDTSD WI +R GI +RHIA + E T+ LG  AA
Sbjct: 3   VMRSVVIGYGAYLPERVMTNAELAGMVDTSDEWIVQRTGIRQRHIAAEGEFTSHLGLKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+ +A++    IDLI++ATSTPD TFP+TAV +QN LG+  G AFD+QAVCSGF++A+
Sbjct: 63  QAAIANAKIDAQSIDLIVLATSTPDHTFPATAVQVQNGLGIHHGAAFDIQAVCSGFIFAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD++++SG  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  +  G+S AD 
Sbjct: 123 AAADNFLKSGAYKRALVIGAETFSRILDWTDRGTCVLFGDGAGAVVLEAQQQPGTS-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T+L SDG + DKLYVDGGPST++TVG +RMEG+ VFK+AV    ++I   F +T  
Sbjct: 182 GILTTHLRSDGRHKDKLYVDGGPSTTQTVGHLRMEGREVFKHAVGMITDVIVDAFAATGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T ++IDW VPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLALA A  +GR+
Sbjct: 242 TAQDIDWLVPHQANKRIIDASARKLDIAPEKVVLTVDQHGNTSAASIPLALATAAGDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KK D ++LEAMGGGFT G+ LLRW
Sbjct: 302 KKNDLVMLEAMGGGFTWGSALLRW 325


>gi|299135073|ref|ZP_07028264.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Afipia sp. 1NLS2]
 gi|298590050|gb|EFI50254.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Afipia sp. 1NLS2]
          Length = 325

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/324 (57%), Positives = 249/324 (76%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G G  LP+RV+SN++L  +V+TSD WI +R GI +RHIA   E T+ LG  AA
Sbjct: 3   VMRSVVIGHGAYLPKRVMSNAELAGMVETSDEWIVQRTGIRQRHIAADGEFTSHLGLKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+  A++    IDLI++ATSTPD TFP+TAV IQN LG+  G AFD+QAVCSGF++A+
Sbjct: 63  QAAIADAKVDAQSIDLIVLATSTPDHTFPATAVQIQNGLGIHHGAAFDLQAVCSGFIFAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD+++++G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE     G+S AD 
Sbjct: 123 ATADNFLKAGTYKRALVIGAETFSRILDWNDRGTCVLFGDGAGAVVLEAQPQAGTS-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T+L SDG++ DKLYVDGGPS+++TVG +RMEG+ VFK+AV    ++I   F +T  
Sbjct: 182 GILTTHLRSDGAHKDKLYVDGGPSSTQTVGHLRMEGREVFKHAVGMITDVIVDAFAATGT 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  +IDW VPHQAN RII++   K+ I   KV++TVD HGNTSAASIPLALA A  +GR+
Sbjct: 242 TANDIDWLVPHQANKRIIDASAKKLDIAPQKVVLTVDRHGNTSAASIPLALATAADDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++LEAMGGGFT G+ LLRW
Sbjct: 302 KRGDLVMLEAMGGGFTWGSALLRW 325


>gi|92117138|ref|YP_576867.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrobacter
           hamburgensis X14]
 gi|91800032|gb|ABE62407.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrobacter
           hamburgensis X14]
          Length = 325

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 251/323 (77%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS V G G  LP+R+L+N++L + VDTSD WI +R GI +RHIA + E T+ L   AA+
Sbjct: 4   IRSVVLGCGSYLPQRILTNAELATKVDTSDEWIVQRTGIRQRHIAAEGEFTSHLALHAAK 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL HA +    IDLI++ATSTPD TFP+TAV +Q  LG+  G AFD+QAVCSGFV+A+ 
Sbjct: 64  AALAHAGIDAQSIDLIVLATSTPDNTFPATAVAVQAGLGIDHGAAFDLQAVCSGFVFALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+++R+G  +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G   +D G
Sbjct: 124 TADNFLRTGAFKRALVIGAETFSRILDWTDRATCVLFGDGAGAVVLEAQEQPGEP-SDRG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T+L SDG +  KLYVDGGPS++RTVG IRMEG+ VFK+AV    ++I   FD++  +
Sbjct: 183 ILTTHLRSDGRHQSKLYVDGGPSSTRTVGYIRMEGREVFKHAVGMITDVIVDAFDASGTS 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            ++IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL+VAV +GR+K
Sbjct: 243 ADDIDWFVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALSVAVADGRIK 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +LLEAMGGGFT G+ LLRW
Sbjct: 303 RGDLVLLEAMGGGFTWGSALLRW 325


>gi|154248305|ref|YP_001419263.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthobacter
           autotrophicus Py2]
 gi|154162390|gb|ABS69606.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthobacter
           autotrophicus Py2]
          Length = 324

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/323 (57%), Positives = 241/323 (74%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS  RG G  LP RVLSN DL   +DT+D WI +R GI +RHIA + E T+ L   AA 
Sbjct: 4   IRSVARGSGSYLPERVLSNDDLARRIDTTDDWIVQRTGIRQRHIAAEGEFTSHLALKAAE 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A  +  DIDLII+AT+TPDQTFP+T+V +Q  LG+ RG AFD+QAVCSGFV+A+ 
Sbjct: 64  RALADAGFAARDIDLIILATATPDQTFPATSVTVQAELGITRGAAFDVQAVCSGFVFALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD+Y+++G   R +VIG++TFSRI+DW DR TCVLFGDGAGA++LE V    +  A  G
Sbjct: 124 TADAYLKTGAFDRALVIGAETFSRILDWEDRGTCVLFGDGAGAMVLEAVREDDAHGA--G 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+++L SDG +  KL+VDGGPST+ TVG +RMEG+ VFK+AV    ++IE  F +T  +
Sbjct: 182 LLTSHLRSDGRHRTKLFVDGGPSTTGTVGHLRMEGREVFKHAVGMITDVIEDAFAATGES 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDWFVPHQAN RII++   K+ I  +KV+ TVD HGNTSAASIPLA  +AV++GR+K
Sbjct: 242 AASIDWFVPHQANRRIIDASALKLGIAPEKVVTTVDQHGNTSAASIPLAFDLAVRDGRIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +LLEAMGGGFT G+ LLRW
Sbjct: 302 RGDLVLLEAMGGGFTWGSALLRW 324


>gi|158423918|ref|YP_001525210.1| beta-ketoacyl-acyl carrier protein synthase III [Azorhizobium
           caulinodans ORS 571]
 gi|158330807|dbj|BAF88292.1| beta-ketoacyl-acyl carrier protein synthase III [Azorhizobium
           caulinodans ORS 571]
          Length = 324

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 194/326 (59%), Positives = 250/326 (76%), Gaps = 8/326 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S VRG+G  LP++VL+N+DL  +VDTSD WI +R GI  RH+A + E T++LG  AA+
Sbjct: 4   IHSVVRGVGSYLPQKVLTNADLAEMVDTSDEWIVQRTGIKERHVAAEGEFTSALGLKAAQ 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  DDIDLII+ATSTPDQTFP+TAV IQ+ LG+ RG AFD+QAVCSGFV+A+ 
Sbjct: 64  AALADAGLVADDIDLIILATSTPDQTFPATAVTIQSELGITRGAAFDLQAVCSGFVFAIA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGV---EVKGSSMA 178
           TAD+++R+G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LEGV   E KG    
Sbjct: 124 TADAHLRTGAFKRALVIGAETFSRILDWNDRGTCVLFGDGAGAIVLEGVPADEAKGR--- 180

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
             G+L+++L SDG +  KL+VDGGPS++ TVG +RMEG+ VFK+AV    ++I   F +T
Sbjct: 181 --GVLTSHLRSDGRHRSKLFVDGGPSSTGTVGHLRMEGREVFKHAVGMITDVIVDAFAAT 238

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             + E IDWFVPHQAN RII++   K+ I  +KV+ TV  HGNTSAASIPLAL VA K+G
Sbjct: 239 GESAETIDWFVPHQANRRIIDASAQKLGIAPEKVVTTVQSHGNTSAASIPLALDVARKDG 298

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K GD +LLEAMGGGFT G+ LLRW
Sbjct: 299 RIKPGDLVLLEAMGGGFTWGSALLRW 324


>gi|85716273|ref|ZP_01047247.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrobacter sp. Nb-311A]
 gi|85696945|gb|EAQ34829.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrobacter sp. Nb-311A]
          Length = 318

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/317 (60%), Positives = 248/317 (78%), Gaps = 1/317 (0%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP+RVL+NS+L + VDTSD WI +R GI +RHIA + E T+ L   AA  AL HA
Sbjct: 3   GCGSYLPQRVLTNSELATKVDTSDEWIVQRTGIRQRHIAAEGEFTSHLAIHAANAALAHA 62

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +    IDLI++ATSTPD TFP+TAV +QN LG+  G AFD+QAVCSGFV+A+ TAD+++
Sbjct: 63  GVDAQSIDLIVLATSTPDHTFPATAVAVQNGLGITHGAAFDLQAVCSGFVFALATADNFL 122

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           RSG  +R +VIG++TFSRI+DW+DRSTCVLFGDGAGA+ILE  E  G   +D GIL+T+L
Sbjct: 123 RSGAFKRALVIGAETFSRILDWTDRSTCVLFGDGAGAVILEAQEQPGEP-SDRGILTTHL 181

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            SDG +  KLYVDGGPS++RTVG +RMEG+ VFK+AV    ++I   FD++  + ++I+W
Sbjct: 182 RSDGRHQSKLYVDGGPSSTRTVGYLRMEGREVFKHAVGMITDVIVAAFDASGTSADDINW 241

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           FVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLAL+VAV +GR+K+GD +L
Sbjct: 242 FVPHQANKRIIDASAHKLHIAPEKVVLTVDRHGNTSAASIPLALSVAVADGRIKRGDLVL 301

Query: 308 LEAMGGGFTSGTVLLRW 324
           LEAMGGGFT G+VL+RW
Sbjct: 302 LEAMGGGFTWGSVLVRW 318


>gi|90424174|ref|YP_532544.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodopseudomonas
           palustris BisB18]
 gi|90106188|gb|ABD88225.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodopseudomonas
           palustris BisB18]
          Length = 325

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 245/322 (76%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G G  LP R+L+N++L + VDTSD WI +R GI +RHIA + E T+ L   AA+ 
Sbjct: 5   RSVVLGCGSYLPERILTNAELAAKVDTSDEWIVQRTGIKQRHIAAEGEFTSHLAIKAAQA 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +    IDLI++ATSTPD TFP+TAV +Q  LG+  G AFD+QAVCSGFV+AV T
Sbjct: 65  ALDDAGIDAQSIDLIVLATSTPDNTFPATAVAVQAALGIHHGAAFDLQAVCSGFVFAVAT 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+++R G  +R +VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  +  G+S+ D G+
Sbjct: 125 ADNFLRGGSFKRALVIGAETFSRILDWNDRGTCVLFGDGAGAIVLEAQQGWGTSV-DHGV 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T+L SDG +  KLYVDGGPS++ TVG +RMEG+ VFK+AV     +I   F+++  T 
Sbjct: 184 LTTHLRSDGRHKSKLYVDGGPSSTGTVGHLRMEGREVFKHAVGMITGVIIDAFEASGTTP 243

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++IDWFVPHQAN RII++   K+ +  +KV++TVD HGNTSAASIPLAL  AVK+GR+KK
Sbjct: 244 KDIDWFVPHQANKRIIDASAHKLHLAPEKVVLTVDRHGNTSAASIPLALDTAVKDGRIKK 303

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G+ +LLEAMGGGFT G+ L+RW
Sbjct: 304 GNLVLLEAMGGGFTWGSALVRW 325


>gi|154253363|ref|YP_001414187.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Parvibaculum
           lavamentivorans DS-1]
 gi|154157313|gb|ABS64530.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Parvibaculum
           lavamentivorans DS-1]
          Length = 325

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 171/312 (54%), Positives = 242/312 (77%), Gaps = 1/312 (0%)

Query: 13  LPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVD 72
           LP R+++N D+  +VDT+D WI  R GI +RHIA  DE T+ L  AAAR A+ HA +   
Sbjct: 15  LPARIMTNEDISKVVDTTDEWIVERTGIHQRHIAADDEMTSHLAIAAARKAIEHAGIDTQ 74

Query: 73  DIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVV 132
           +ID II+AT+TPDQTFP+TA  +Q  LG+  G AFD+QAVCSGFVYA+T AD++I++G  
Sbjct: 75  EIDTIILATTTPDQTFPATAATVQAELGLHHGAAFDIQAVCSGFVYALTIADTFIKTGQS 134

Query: 133 RRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGS 192
           +  +VIG++TFSR++DW+DR+TCVLFGDGAGA++++G+E +G++ +D GIL+ +L SDG 
Sbjct: 135 KTALVIGAETFSRLLDWTDRTTCVLFGDGAGAVVVKGMEGEGNN-SDQGILTAHLHSDGR 193

Query: 193 YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQ 252
           Y DKLYVDGGPS++++ G +RMEG+ VF++AV    E I +  ++T L+ ++IDWFVPHQ
Sbjct: 194 YRDKLYVDGGPSSTQSTGHVRMEGREVFRHAVVNIAEAINESLEATGLSADDIDWFVPHQ 253

Query: 253 ANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMG 312
           AN RI++    ++ +P +KV++TV   GNTSAAS+PLAL  AVK+GR+K+G  +LLEAMG
Sbjct: 254 ANKRILDGTAKRIGLPPEKVVLTVADQGNTSAASVPLALDAAVKDGRIKRGQLVLLEAMG 313

Query: 313 GGFTSGTVLLRW 324
           GGFT G++L R+
Sbjct: 314 GGFTWGSLLFRF 325


>gi|23014672|ref|ZP_00054477.1| COG0332: 3-oxoacyl-[acyl-carrier-protein] synthase III
           [Magnetospirillum magnetotacticum MS-1]
          Length = 324

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 241/323 (74%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS + G G  LP R+++N++L + VDT+D WI  R GI +RHIA + ETT+ L   AA
Sbjct: 2   IVRSQIIGCGSYLPSRLVTNAELAAKVDTTDEWIVERSGIRQRHIAAEGETTSDLATNAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A ++   +DL+IVAT+TPD TFP+TA  +Q+R+GMK GFAFD+QAVCSGFVYA+
Sbjct: 62  LRALEAAGIAGSAVDLVIVATATPDNTFPATATKVQSRIGMKHGFAFDVQAVCSGFVYAL 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD++I+SG V+  +VIG++TFSRI+DW+DR+TCVLFGDGAGA++L     KGSS AD 
Sbjct: 122 SVADNFIKSGQVQTALVIGAETFSRILDWNDRTTCVLFGDGAGAVVLRANRGKGSS-ADR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST+L SDGS+ D LYVDGGPS+++TVG + MEG+ VF++AV     ++ +   +  L
Sbjct: 181 GILSTHLHSDGSHYDLLYVDGGPSSTQTVGHVHMEGREVFRHAVINLASVVGEALSANDL 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              +IDW VPHQAN RII     K+  P DK+++TVD H NTSAASIPLAL  AV +GR+
Sbjct: 241 KASDIDWVVPHQANRRIIEGTAKKLGFPLDKMVMTVDRHANTSAASIPLALTEAVSDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K G  +LLEAMGGGFT G+ L+R
Sbjct: 301 KPGQLVLLEAMGGGFTWGSALVR 323


>gi|296445656|ref|ZP_06887611.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylosinus
           trichosporium OB3b]
 gi|296256901|gb|EFH03973.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylosinus
           trichosporium OB3b]
          Length = 329

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 186/323 (57%), Positives = 246/323 (76%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS V G+G  LP RVL+N +L ++VDTSD WI +R GI  R IA   ETT+ LGE AAR
Sbjct: 8   LRSVVLGVGSYLPERVLANEELATLVDTSDEWIVQRTGIKERRIAAPGETTSMLGERAAR 67

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++ +DIDLI+V TSTPD TFPSTA  IQ  LG+ RG AFD+QAVCSGFV+A+ 
Sbjct: 68  AALAAAGLAPEDIDLIVVGTSTPDYTFPSTATQIQAALGVHRGVAFDLQAVCSGFVFALA 127

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++RSG  +R +VIG++TFSRI+DW+DR+TCVLFGDGAGA++LE  E  G SM + G
Sbjct: 128 TADKFLRSGSHKRALVIGAETFSRIIDWTDRTTCVLFGDGAGAMVLEARESAG-SMDERG 186

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+T+L SDG +  KL+VDGGPS ++TVG +RMEGK VF++AV +  +++   F +T  T
Sbjct: 187 VLTTHLRSDGRHRAKLHVDGGPSATQTVGHLRMEGKEVFRFAVGQVTDVVVDAFAATGYT 246

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++ WFVPHQAN RII+    K+ I  +K++ TV +HGNTSAASIPLALAVA  +GR+ 
Sbjct: 247 AKDLQWFVPHQANRRIIDMSAAKLGIAQEKIVATVHLHGNTSAASIPLALAVAAGDGRIG 306

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++LEA+GGGFT G+ L+RW
Sbjct: 307 RGDLVMLEAVGGGFTWGSALIRW 329


>gi|89069688|ref|ZP_01157025.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanicola
           granulosus HTCC2516]
 gi|89044768|gb|EAR50874.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanicola
           granulosus HTCC2516]
          Length = 322

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 233/324 (71%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+R+ V+GIG  LP RV+ N++ E+ +DT+D WI+ R GI RRH A + +TT+ L + AA
Sbjct: 1   MLRAVVKGIGHYLPERVVENAEFEATLDTTDEWIRSRSGIERRHFAAEGQTTSDLAQRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A  + DDID IIVATST D TFPS A  +QNRLGM RGFAFD+QAVC+GFVYA+
Sbjct: 61  EKALEMAGFAPDDIDAIIVATSTADFTFPSAATMVQNRLGMTRGFAFDVQAVCAGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             A++ I SG   RVMVIG++TFSRI+DW+DRSTCVLFGDGAGALIL+  E  G   AD 
Sbjct: 121 ANANALILSGQAERVMVIGAETFSRIMDWTDRSTCVLFGDGAGALILQAEEGAGDG-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST L SDG Y D LYVDGG ST  T G +RM+G+ VF++AVEK  E          L
Sbjct: 180 GILSTDLNSDGRYRDLLYVDGGISTG-TSGVLRMQGREVFRHAVEKLAETAHAALARAGL 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
             E++DW VPHQAN RII S   K+ +  DKV+VTV  HGNTSAASIPLAL+V V  G++
Sbjct: 239 GHEDVDWVVPHQANIRIIQSTAKKLGLDMDKVVVTVQDHGNTSAASIPLALSVGVARGQI 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K GD ++ EA+GGG   G+V++RW
Sbjct: 299 KPGDVVVTEAIGGGLAWGSVVIRW 322


>gi|83311453|ref|YP_421717.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Magnetospirillum
           magneticum AMB-1]
 gi|123541854|sp|Q2W4R7|FABH_MAGMM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|82946294|dbj|BAE51158.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Magnetospirillum
           magneticum AMB-1]
          Length = 324

 Score =  371 bits (952), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 241/323 (74%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS + G G  LP R+++N++L + VDTSD WI  R GI +RHIA + ETT+ L   AA
Sbjct: 2   IVRSQIIGCGSYLPSRLVTNAELAAQVDTSDEWIVERSGIRQRHIAAEGETTSDLATNAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +S   +DL+IVAT+TPD TFP+TA  +Q+R+GM+ GFAFD+QAVCSGFVYA+
Sbjct: 62  LRALEAAGISGSAVDLVIVATATPDNTFPATATKVQSRIGMRHGFAFDVQAVCSGFVYAL 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD++I+SG V+  +VIG++TFSRI+DW+DR+TCVLFGDGAGA++L     KGSS AD 
Sbjct: 122 SVADNFIKSGQVQTALVIGAETFSRILDWTDRTTCVLFGDGAGAVVLRASRGKGSS-ADR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST+L SDGS+ D LYVDGGPS+++TVG + MEG+ VF++AV     ++ +   +  L
Sbjct: 181 GILSTHLHSDGSHYDLLYVDGGPSSTQTVGHVHMEGREVFRHAVINLAAVVGEALAANDL 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              +IDW VPHQAN RII     K+  P DK+++TV+ H NTSAASIPLAL  AV +GR+
Sbjct: 241 KASDIDWVVPHQANRRIIEGTAKKLGFPLDKMVMTVERHANTSAASIPLALTEAVGDGRI 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K G  +LLEAMGGGFT G+ L+R
Sbjct: 301 KPGQLVLLEAMGGGFTWGSALVR 323


>gi|83858236|ref|ZP_00951758.1| 3-oxoacyl-(acyl carrier protein) synthase [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853059|gb|EAP90911.1| 3-oxoacyl-(acyl carrier protein) synthase [Oceanicaulis alexandrii
           HTCC2633]
          Length = 322

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/324 (54%), Positives = 238/324 (73%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + GIG  LP +VL+N  +E+IV+TSD WI+ R GI++RHIA   E T+ LG  AA
Sbjct: 1   MTYSRIAGIGSHLPEKVLTNKGMEAIVETSDEWIRERTGITKRHIAADGEYTSDLGVQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A +S+D +DLIIVAT+TPD TFP+TA  +Q++LG+K+GFAFD+ AVCSGF+YA+
Sbjct: 61  RKAVDQAGLSLDQVDLIIVATATPDLTFPATATIVQHKLGIKQGFAFDVHAVCSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TADS++R+G  +  +VIG++TFSRI+DW+DR+TCVLFGDGAGA++L   E  G      
Sbjct: 121 ATADSFLRTGQAKCALVIGAETFSRILDWTDRTTCVLFGDGAGAMVLTAEE--GDPAEFK 178

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L TYL SDG Y D LYVDGGPS ++TVG +RM+G  VF++AV K    +  +   T +
Sbjct: 179 GVLKTYLESDGEYCDLLYVDGGPSRTKTVGHLRMQGNQVFRHAVTKISGAMTTLCAQTGV 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            I +IDW VPHQAN RI+  +  K+ I  D+V+ TV  HGNTSAASIPLA   AV++GR+
Sbjct: 239 DIADIDWVVPHQANQRILLGVAKKLGISVDQVVSTVAEHGNTSAASIPLAFDAAVRDGRI 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +L+EA+GGGFT G  L R+
Sbjct: 299 KRGDTVLMEALGGGFTWGAALARY 322


>gi|146277949|ref|YP_001168108.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter
           sphaeroides ATCC 17025]
 gi|166233390|sp|A4WTT9|FABH_RHOS5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|145556190|gb|ABP70803.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 323

 Score =  367 bits (943), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 240/323 (74%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP R++ NS+LE++V+T+D WI+ R GI RRH A + +TT+ L   AAR
Sbjct: 3   IRAVVRGVGHYLPDRIVPNSELEALVETTDEWIRTRSGIERRHFAAEGQTTSDLAARAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  DDID +IVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFVYA+ 
Sbjct: 63  AALADAGLQPDDIDTLIVATSTADLTFPSAATMVQAALGMSRGFAFDVQAVCAGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD+ IRSG   RV+VIG++TFSR++DWSDR+TCVLFGDGAGAL+LEG E  G+S AD G
Sbjct: 123 NADALIRSGQANRVLVIGAETFSRLMDWSDRATCVLFGDGAGALVLEGAEGAGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG + D LYVDGG ST  T G +RM+G+ VF++AVEK  E      D   LT
Sbjct: 182 ILATDLHSDGRFKDLLYVDGGASTGST-GHLRMQGREVFRHAVEKLAETAHTALDKAGLT 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII++   +M++P D+VI+TV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 SADVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDHGNTSAASIPLALSVGKARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD L+ EA+GGG   G+V+LRW
Sbjct: 301 EGDLLVTEAIGGGLAWGSVVLRW 323


>gi|300022814|ref|YP_003755425.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299524635|gb|ADJ23104.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 326

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 240/324 (74%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS +RG+G  LP+R++SN DL  IVDTSD WI+ R GI  RHIA + E T+ LG AAA
Sbjct: 4   VLRSVIRGVGAHLPKRIVSNEDLSKIVDTSDAWIQERSGIVNRHIADETEKTSDLGAAAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +   DIDLI+ AT+TPD+TFP+TAV IQ+ LG+ +G AFD+QAVCSGFVY +
Sbjct: 64  KQALVRAGIDPIDIDLIVCATATPDRTFPATAVRIQSMLGVTKGAAFDVQAVCSGFVYGL 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T AD+++++G  +R +VIG++TFSRI+DWSDRSTCVLFGDGAGA++LE     G+   D 
Sbjct: 124 TIADNFLKTGQSKRALVIGAETFSRILDWSDRSTCVLFGDGAGAVVLEAQPQHGTR-NDR 182

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T L SDG Y D LYVDGG  +++TVG +RM G+ VF++A++K   +IE+    T  
Sbjct: 183 GILATRLRSDGRYEDLLYVDGGAGSTKTVGHLRMNGREVFRHAIQKISGVIEETLVETGY 242

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
             + ID F+PHQAN RI++ I  K+ +  +K+++T+  HGNTSAASIPLAL  A +  RV
Sbjct: 243 AADEIDLFIPHQANKRILDGIAKKLGVAPEKIVMTLHKHGNTSAASIPLALNEAFEAHRV 302

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+G  +L+EAMGGGFT G VL RW
Sbjct: 303 KEGSLILMEAMGGGFTWGAVLARW 326


>gi|87200379|ref|YP_497636.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Novosphingobium
           aromaticivorans DSM 12444]
 gi|123488860|sp|Q2G5S1|FABH_NOVAD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|87136060|gb|ABD26802.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 325

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 240/322 (74%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS +RG G +LPRR +SN+++ ++VDT+D WI  R GI  R+IAG+ ETT++L   AAR
Sbjct: 3   VRSVIRGSGSALPRRAVSNAEMTTMVDTTDEWIVERTGIRNRYIAGEGETTSTLATEAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    IDLI++AT+TPDQTFP+TA  +Q+ LG   G AFD+ AVCSGF+YA+ 
Sbjct: 63  KALEAAGVDASRIDLIVLATATPDQTFPATATIVQHNLGCNGGIAFDVAAVCSGFLYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TADS IRSG+ R  +VIG++T SR++DW DR+TCVLFGDGAGA++LE V+V  +     G
Sbjct: 123 TADSMIRSGMARCALVIGAETMSRLLDWEDRTTCVLFGDGAGAVVLEAVDVDETDPKAPG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L +DG++ + LYVDGGPST+ TVG +RM+G+ VF++AV     ++++V ++T   
Sbjct: 183 ILATRLHADGAHNELLYVDGGPSTTGTVGKLRMKGREVFRHAVTNLANVLKEVLETTGHD 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E IDW VPHQAN+RI+++   K+ +P DKVIVTVD H NTSAAS+PLA   AV++GR+K
Sbjct: 243 AEEIDWVVPHQANFRILDATARKLDLPADKVIVTVDHHANTSAASVPLAYDTAVRDGRIK 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
            GD ++ EAMGGGFT G  L R
Sbjct: 303 PGDLVMFEAMGGGFTWGASLAR 324


>gi|312114065|ref|YP_004011661.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311219194|gb|ADP70562.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 325

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 185/322 (57%), Positives = 237/322 (73%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G G  LP RVL+N DL  IVDTSD WI  R GI  RHIA   E T+ LG AAAR 
Sbjct: 5   RSVVLGCGSYLPERVLTNQDLARIVDTSDEWISDRSGIKTRHIAADGEMTSDLGIAAARA 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL HA +    +D II+ATSTPD TFPSTA  IQ  LG+  GFAFD+QAVCSGF YA+ T
Sbjct: 65  ALDHAGIDPQSLDFIILATSTPDNTFPSTATTIQAGLGLTHGFAFDVQAVCSGFAYALAT 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD++IR+G  +R +VIG++TFSRI+DW DR TCVLFGDGAGA++LE  +V+   M +  I
Sbjct: 125 ADNFIRAGQGKRGLVIGAETFSRILDWEDRGTCVLFGDGAGAVVLEATQVQ-DPMRERCI 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           + + L SDG + DKLYVDGGPS+++TVG +RM+GK VF++AV    +++E+   + +L  
Sbjct: 184 IGSMLFSDGRHKDKLYVDGGPSSTQTVGHLRMQGKEVFRFAVNAISDVVERTLAAHNLRP 243

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDWFVPHQAN RI++    K+ I  +K+++T+D HGNTSAASIPLAL+ AV +GR+K+
Sbjct: 244 SDIDWFVPHQANKRILDGTAKKVGIAEEKIVITLDRHGNTSAASIPLALSTAVHDGRIKR 303

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD +L EAMGGGFT G  L+RW
Sbjct: 304 GDLVLFEAMGGGFTWGANLVRW 325


>gi|298291650|ref|YP_003693589.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Starkeya novella DSM
           506]
 gi|296928161|gb|ADH88970.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Starkeya novella DSM
           506]
          Length = 323

 Score =  365 bits (938), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 249/324 (76%), Gaps = 5/324 (1%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IRS VRG+G  LP R+L+N+DL  +VDTSD WI +R GI  RHIA  +E T+ L  AAAR
Sbjct: 4   IRSVVRGVGAYLPARMLTNADLALMVDTSDEWIVQRTGIRTRHIAADNEVTSDLALAAAR 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DIDLI++ATSTPD TFP+TAV++Q  LG+  G AFD+QAVCSGFV+A+ 
Sbjct: 64  AALADAGLEPGDIDLIVLATSTPDNTFPATAVSVQAGLGITHGAAFDLQAVCSGFVFALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD-T 180
           TAD++++SG  +R +VIG++TFSRI+DWSDR+TCVLFGDGAGA++LE      +  AD  
Sbjct: 124 TADNFLKSGAYKRCLVIGAETFSRILDWSDRTTCVLFGDGAGAMVLEAA----TDGADGR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T+L SDG + +KLYVDGG S++R+VG +RMEG+ VF++AV    ++I   FD+T  
Sbjct: 180 GVLTTHLRSDGRHKNKLYVDGGVSSTRSVGFLRMEGREVFRHAVGMITDVITDAFDATGE 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + + IDWFVPHQAN RII++   K+ I  +KV++TVD HGNTSAASIPLALA A  +GR+
Sbjct: 240 SAQTIDWFVPHQANRRIIDASAVKLGIAPEKVVITVDQHGNTSAASIPLALAAAHADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +LLEAMGGGFT G+ L+RW
Sbjct: 300 KKGDLVLLEAMGGGFTWGSALIRW 323


>gi|254462454|ref|ZP_05075870.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium HTCC2083]
 gi|206679043|gb|EDZ43530.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 322

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 233/324 (71%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ ++G+G  LP  V+ N+  E  ++TS+ WI  R GI RRH A +DETT+ L   AA
Sbjct: 1   MKRAHIKGVGHYLPENVVPNAHFEKTLETSNDWIISRSGIERRHFAAEDETTSHLASHAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +  +D+D +IVATSTPD TFPS A  +Q+++GM  GFAFD+QAVC+GFV+A+
Sbjct: 61  RAALKDAGLEANDLDALIVATSTPDLTFPSAATMVQHQIGMTGGFAFDIQAVCAGFVFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             A++ I SG  +RVMVIG++TFSRI+DW+DR TCVLFGDGAGALILE  +  G++  D 
Sbjct: 121 ANANALIVSGTAKRVMVIGAETFSRIMDWTDRGTCVLFGDGAGALILEAADGDGTAQ-DR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T L SDG+Y D LYVDGG ST +T G +RMEGK VF++A+EK         DS  +
Sbjct: 180 GVLATDLNSDGTYRDILYVDGGVST-KTTGYLRMEGKEVFRHAIEKLAATAHTAMDSAGV 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T E++DW VPHQAN RII     KM +P + VIVTV  HGNTSAASIPLAL+V   EG++
Sbjct: 239 TSEDVDWVVPHQANIRIIKGTAKKMNMPMENVIVTVQDHGNTSAASIPLALSVGKAEGKL 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD ++ EA+GGG   G V+LRW
Sbjct: 299 KQGDLVVTEAIGGGLAWGAVVLRW 322


>gi|84500954|ref|ZP_00999189.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanicola batsensis
           HTCC2597]
 gi|84391021|gb|EAQ03439.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanicola batsensis
           HTCC2597]
          Length = 324

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 180/323 (55%), Positives = 224/323 (69%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+   GIG  LP RV+ NS+ E  +DT+D WI+ R GI RRH A +DETT+ +   AA 
Sbjct: 3   VRAVPTGIGHYLPERVVPNSEFEKTLDTTDEWIRTRSGIERRHFAAEDETTSQMAVRAAE 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++ DDID +IVATSTPD TFPS    +Q  LGM RGFA+D+QAVC+GF++A+ 
Sbjct: 63  QALQMARLAPDDIDAVIVATSTPDLTFPSVGTMVQEGLGMTRGFAYDVQAVCAGFIFALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+  I SG   RV+VIG++TFSRI+DW DR+TCVLFGDGAGAL+LE     G S  D G
Sbjct: 123 NANGMILSGQAERVLVIGAETFSRIMDWEDRATCVLFGDGAGALVLEARTGTGKS-DDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS  L SDG Y D LYVDGG STS T G +RM+G  +F+ AV K  E  +      HLT
Sbjct: 182 ILSVDLNSDGKYRDMLYVDGGVSTSGTAGKLRMQGNPLFRQAVAKLTETADAALAKAHLT 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     KM +P +KVIVTV  HGNTSAASIPLAL+V V EG+++
Sbjct: 242 GADVDWIVPHQANIRIIQGTAKKMGLPMEKVIVTVQDHGNTSAASIPLALSVGVTEGKIR 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD L+ EA+GGG   G V++RW
Sbjct: 302 SGDLLVAEAIGGGLAWGAVVMRW 324


>gi|260427652|ref|ZP_05781631.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Citreicella sp. SE45]
 gi|260422144|gb|EEX15395.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Citreicella sp. SE45]
          Length = 323

 Score =  365 bits (937), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 184/323 (56%), Positives = 233/323 (72%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ V G+G  LP RV+ NS+ E  +DTSD WI+ R GI RRH A + +TT+ L   AA 
Sbjct: 3   IRAQVAGVGHYLPERVVPNSEFEKTLDTSDEWIRTRSGIERRHFAAEGQTTSELATRAAI 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++  D+D +IVATSTPD TFPS A  +Q RLGM +GFAFD+QAVC+GFVYA+T
Sbjct: 63  AALEDAGLAASDLDALIVATSTPDLTFPSAATMVQARLGMDQGFAFDVQAVCAGFVYALT 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  RRVMVIG++TFSRI+DW+DRSTCVLFGDGAGALILE    +G+S  D G
Sbjct: 123 NANALIVSGAARRVMVIGAETFSRILDWNDRSTCVLFGDGAGALILEAGTGEGTS-DDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS  L SDG Y D LYVDGG ST+ ++G +RMEGK VF++AV K     E   +   LT
Sbjct: 182 VLSVDLHSDGRYRDLLYVDGGVSTN-SIGHLRMEGKEVFRHAVGKLAATAEAAMEKAGLT 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW VPHQAN RII     K+ +P +KVIVTV  HGNTSAASIP+AL+V   EG+++
Sbjct: 241 GADIDWIVPHQANIRIIQGTAKKLGLPMEKVIVTVQDHGNTSAASIPMALSVGKAEGKIR 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G+ ++ EA+GGG   G V+LRW
Sbjct: 301 RGELVVTEAIGGGLAWGAVVLRW 323


>gi|209964629|ref|YP_002297544.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodospirillum
           centenum SW]
 gi|259646343|sp|B6IMR5|FABH_RHOCS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|209958095|gb|ACI98731.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodospirillum
           centenum SW]
          Length = 323

 Score =  365 bits (936), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 244/323 (75%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS + G G  LP RVL+N DL  IV+TSD WI  R GI  RHIA   E T+ L EAAAR
Sbjct: 3   LRSVILGCGAYLPARVLTNEDLTRIVETSDEWIVERTGIKSRHIAADGENTSDLAEAAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL HA ++ +++DLI++AT+TPDQTFP+TA  +Q RLG+ RG AFD+QAVCSGFVYA+ 
Sbjct: 63  AALAHAGVAAEEVDLIVLATATPDQTFPATATKVQARLGITRGAAFDVQAVCSGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD++I++G  R  +VIG++TFSRI+DW+DR+TCVLFGDGAGA++L   E +G+  AD G
Sbjct: 123 IADNFIKAGQARTALVIGAETFSRILDWTDRTTCVLFGDGAGAVVLRAEEGEGT--ADRG 180

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST+L SDG + D LYVDGGPST++TVG +RM+G+ VFK+AV     ++E+   +  L+
Sbjct: 181 ILSTHLHSDGRHHDLLYVDGGPSTTQTVGHLRMKGQEVFKHAVVNLAHVVEEALAANGLS 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +I W VPHQAN RII S   K+K+   +V++TVD HGNTSAASIPLAL  AV +GRV+
Sbjct: 241 PADISWLVPHQANRRIIESTARKLKLDGSRVVLTVDHHGNTSAASIPLALCEAVHDGRVQ 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +LLEAMGGGFT G  L+RW
Sbjct: 301 RGDIVLLEAMGGGFTWGAALVRW 323


>gi|163746486|ref|ZP_02153844.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanibulbus
           indolifex HEL-45]
 gi|161380371|gb|EDQ04782.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Oceanibulbus
           indolifex HEL-45]
          Length = 323

 Score =  364 bits (934), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 230/323 (71%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G G  LP RV+ N++ E+ +DT+D WI+ R GI RRH A + E T+S+  AAAR
Sbjct: 3   LRAVVTGCGHYLPARVVENAEFEATLDTNDEWIRSRSGIERRHFAAEGENTSSMASAAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A    DD+D IIVATSTPD TFPS A  +Q  LGM  GFAFD+QAVC+GFVYA+ 
Sbjct: 63  KALEDAGREADDVDAIIVATSTPDLTFPSAATMVQAELGMTSGFAFDVQAVCAGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  RRV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  E  GS   D G
Sbjct: 123 NANALIVSGQARRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALLLEAQESNGSP-EDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG Y + LYVDGG ST  T G +RM+G  VF++AVEK         +   ++
Sbjct: 182 ILATDLNSDGRYRELLYVDGGVSTG-TTGYLRMQGNQVFRHAVEKLAATANTAMERAGVS 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DW VPHQAN RII     K+ +P ++V+VTV  HGNTSAASIPLAL+V  + G++K
Sbjct: 241 AEDVDWIVPHQANIRIIQGTAKKLNLPMERVVVTVQDHGNTSAASIPLALSVGRERGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++ EA+GGG   G+V+LRW
Sbjct: 301 EGDLIVTEAIGGGLAWGSVVLRW 323


>gi|126726951|ref|ZP_01742790.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium HTCC2150]
 gi|126703909|gb|EBA03003.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium HTCC2150]
          Length = 324

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 179/322 (55%), Positives = 241/322 (74%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V+G+G  LP+RV+ N++LE  VDT+D WI+ R GI RRHIA K E T+ LG AAA+ 
Sbjct: 4   RAVVKGVGHYLPKRVVENAELEKTVDTTDDWIRSRSGIERRHIAAKGEFTSDLGAAAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A MS DDID I+VATSTPD TFPS A  IQN+LGM +G+ FD+QAVC+GFV+A+T 
Sbjct: 64  ALDNAGMSADDIDAIVVATSTPDLTFPSCATMIQNKLGMTKGYGFDIQAVCAGFVFALTN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIG++TFSRI+DW DR+TCVLFGDGAGAL+LE  E +G++  D G+
Sbjct: 124 ANALIVSGQAERVLVIGAETFSRIMDWEDRATCVLFGDGAGALVLEAAEGEGTN-DDRGL 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+  L SDG + D LYVDGG S+++  G +RM+GK VF++AVEK         D  ++T 
Sbjct: 183 LAFDLNSDGRHKDILYVDGGVSSNQQTGFLRMQGKEVFRHAVEKLAATAHTSLDKLNMTG 242

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           +++DW VPHQAN RII    ++M +  D+V+VTV  HGNTSAASIPLAL+V V+ G++K+
Sbjct: 243 DDVDWIVPHQANLRIIKGTANRMGVGMDRVVVTVSDHGNTSAASIPLALSVGVERGQIKQ 302

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  ++ EA+GGG   G+V++RW
Sbjct: 303 GHVIVTEAIGGGLAWGSVVIRW 324


>gi|217976839|ref|YP_002360986.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylocella
           silvestris BL2]
 gi|217502215|gb|ACK49624.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylocella
           silvestris BL2]
          Length = 329

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 244/323 (75%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S V G+G  LP+R++SN+DLE +++TSD WI +R GI +RHIA +DE T+ LG  AA 
Sbjct: 9   LSSVVVGLGSYLPKRIVSNADLEKVLETSDEWIVQRTGIRQRHIASEDEPTSKLGVNAAT 68

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL+ A ++  DIDLIIVATSTPD TFPS A  +Q  LGM  G AFD+QAVCSGFV+AV 
Sbjct: 69  AALNDAGLTEADIDLIIVATSTPDFTFPSVATQVQAALGMTHGAAFDLQAVCSGFVFAVA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++RSG  +R +VIG++TFSR++DW+DR+TCVLFGDGAGALILE      S+    G
Sbjct: 129 TADKFLRSGSHKRALVIGAETFSRLLDWTDRTTCVLFGDGAGALILEA--QPDSAAMGRG 186

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+++L SDG + + LYV+GGPS+++T G +RM G+ VF++AV    +++ + F +T  T
Sbjct: 187 VLTSHLRSDGRHREALYVNGGPSSTKTTGVLRMAGREVFRHAVGMVSDVVTEAFAATGTT 246

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DWFVPHQAN RII++  +K+KI   KV+ TVD+H NTSAASIPLAL VA  +GR+K
Sbjct: 247 AADLDWFVPHQANRRIIDASAEKLKIAPHKVVTTVDLHANTSAASIPLALCVARDDGRIK 306

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EAMGGGFT  + L+RW
Sbjct: 307 RGDLVMIEAMGGGFTWASALIRW 329


>gi|77463166|ref|YP_352670.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodobacter
           sphaeroides 2.4.1]
 gi|123592158|sp|Q3J365|FABH_RHOS4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|77387584|gb|ABA78769.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodobacter
           sphaeroides 2.4.1]
          Length = 323

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/323 (57%), Positives = 240/323 (74%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ NS+LE+IV+T+D WI+ R GI RRH A + +TT+ L   AAR
Sbjct: 3   IRAVVRGVGHYLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEGQTTSDLAARAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  DDID +IVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFVYA+ 
Sbjct: 63  AALEDAGLQPDDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD+ IRSG  +RV+VIG++TFSR++DW+DR+TCVLFGDGAGA++LEG E  G+S AD G
Sbjct: 123 NADALIRSGQAQRVLVIGAETFSRLMDWNDRATCVLFGDGAGAVVLEGTESAGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG + D LYVDGG ST  T G +RM+G+ VF++AVEK  E      +   L 
Sbjct: 182 ILATDLHSDGRFKDLLYVDGGSSTG-TTGHLRMQGREVFRHAVEKLAETAHTALEKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII++   +M++P D+VI+TV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 AGDVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDHGNTSAASIPLALSVGKARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD L+ EA+GGG   G+V+LRW
Sbjct: 301 EGDLLVTEAIGGGLAWGSVVLRW 323


>gi|126462038|ref|YP_001043152.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter
           sphaeroides ATCC 17029]
 gi|166233389|sp|A3PJ64|FABH_RHOS1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|126103702|gb|ABN76380.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodobacter
           sphaeroides ATCC 17029]
          Length = 323

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/323 (57%), Positives = 240/323 (74%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ NS+LE+IV+T+D WI+ R GI RRH A + +TT+ L   AAR
Sbjct: 3   IRAVVRGVGHYLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEGQTTSDLAARAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  DDID +IVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFVYA+ 
Sbjct: 63  AALDDAGLQPDDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD+ IRSG  +RV+VIG++TFSR++DW+DR+TCVLFGDGAGA++LEG E  G+S AD G
Sbjct: 123 NADALIRSGQAQRVLVIGAETFSRLMDWNDRATCVLFGDGAGAVVLEGTESAGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG + D LYVDGG ST  T G +RM+G+ VF++AVEK  E      +   L 
Sbjct: 182 ILATDLHSDGRFKDLLYVDGGSSTG-TTGHLRMQGREVFRHAVEKLAETAHTALEKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII++   +M++P D+VI+TV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 AGDVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDHGNTSAASIPLALSVGKARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD L+ EA+GGG   G+V+LRW
Sbjct: 301 EGDLLVTEAIGGGLAWGSVVLRW 323


>gi|304319841|ref|YP_003853484.1| 3-oxoacyl-(acyl carrier protein) synthase [Parvularcula bermudensis
           HTCC2503]
 gi|303298744|gb|ADM08343.1| 3-oxoacyl-(acyl carrier protein) synthase [Parvularcula bermudensis
           HTCC2503]
          Length = 327

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 232/322 (72%), Gaps = 2/322 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
            R   RG G +LP R+L+N++L + V+TSD WI+ R GI  R +AG +ETTA L E AA+
Sbjct: 7   FRPLYRGCGAALPDRILTNAELSTRVETSDEWIRSRTGIQERRLAGPEETTADLAERAAQ 66

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A MS DDIDL+++AT+TPD TFPSTA  +Q RLGM +G AFD+ AVC+GFVYA+ 
Sbjct: 67  KALSDAGMSADDIDLLVLATATPDLTFPSTATIVQGRLGMTKGAAFDVHAVCTGFVYALA 126

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TA +++  G  RR +VIG++TFSR++DW+DR+TCVLFGDGAGA++LE V  +  +  D G
Sbjct: 127 TASNFLSCGQHRRALVIGAETFSRLLDWTDRTTCVLFGDGAGAMVLEAVPTE--TAGDRG 184

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LSTYLCSDG   D LYVDGGPS + TVG +RM+G  VFK AV +  + + K  +   + 
Sbjct: 185 VLSTYLCSDGRLTDLLYVDGGPSRTGTVGHLRMQGNKVFKAAVIRIADAMAKAAERADIP 244

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
           +  IDWFVPHQAN RII  +VD++ +  ++V+ T+  HGNTSAASIPLA   A ++GR+K
Sbjct: 245 LTEIDWFVPHQANERIIGGVVDRLNLDRNRVVSTIARHGNTSAASIPLAFETARRDGRLK 304

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
            GD + +E MGGG T G  L+R
Sbjct: 305 DGDLVAIEGMGGGLTWGAGLMR 326


>gi|332558040|ref|ZP_08412362.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Rhodobacter
           sphaeroides WS8N]
 gi|332275752|gb|EGJ21067.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Rhodobacter
           sphaeroides WS8N]
          Length = 323

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 186/323 (57%), Positives = 240/323 (74%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ NS+LE+IV+T+D WI+ R GI RRH A + +TT+ L   AAR
Sbjct: 3   IRAVVRGVGHYLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEGQTTSDLAARAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  DDID +IVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFVYA+ 
Sbjct: 63  AALEDAGLQPDDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD+ IRSG  +RV+VIG++TFSR++DW+DR+TCVLFGDGAGA++LEG E  G+S AD G
Sbjct: 123 NADALIRSGQAQRVLVIGAETFSRLMDWNDRATCVLFGDGAGAVVLEGTESAGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG + D LYVDGG ST  T G +RM+G+ VF++AVEK  E      +   L 
Sbjct: 182 ILATDLHSDGRFKDLLYVDGGSSTG-TTGHLRMQGREVFRHAVEKLAETAHTALEKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII++   +M++P D+VI+TV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 GGDVDWIVPHQANLRIISATAQRMQVPMDRVILTVQDHGNTSAASIPLALSVGKARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD L+ EA+GGG   G+V+LRW
Sbjct: 301 EGDLLVTEAIGGGLAWGSVVLRW 323


>gi|288957865|ref|YP_003448206.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Azospirillum sp.
           B510]
 gi|288910173|dbj|BAI71662.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Azospirillum sp.
           B510]
          Length = 323

 Score =  362 bits (929), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 241/324 (74%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G G  LP  V++N DLE  VDTSD WI +R GI  RHIA + E T+ L  AAA
Sbjct: 2   VMRSRVLGCGFFLPSNVVTNQDLEQRVDTSDEWIVQRTGIRSRHIAAEGEKTSDLAIAAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL HA ++ D ID I++AT+TPD TFP+TA  +Q  LG  RGFA D+QAVC+GFVYA+
Sbjct: 62  IRALEHAGVAADSIDCILLATTTPDNTFPATATRVQAALG-TRGFAMDIQAVCAGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+++RSG  RR +VIG++TFSR++DW+DR+TCVLFGDGAGA++LE  E KG S  D 
Sbjct: 121 SVADNFLRSGQARRALVIGAETFSRLLDWNDRTTCVLFGDGAGAIVLEAYEAKGDS-TDR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+LST+L SDG+  D LYVDGG ST+ T+G +RM G+ +F++AV K   ++E+   +  L
Sbjct: 180 GVLSTHLHSDGNQYDLLYVDGGVSTTGTIGHVRMHGQEIFRHAVSKLSAVVEEALAANGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              +IDW VPHQAN RII+ +  KMK+  +KV++TVD HGNTSAASIPLAL  AV +GR+
Sbjct: 240 ESADIDWMVPHQANRRIIDGLARKMKLSPEKVVLTVDRHGNTSAASIPLALGEAVADGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +L+EA+GGG T G+ L+RW
Sbjct: 300 KRGDLILMEAIGGGLTWGSALIRW 323


>gi|254510949|ref|ZP_05123016.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacteraceae
           bacterium KLH11]
 gi|221534660|gb|EEE37648.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacteraceae
           bacterium KLH11]
          Length = 323

 Score =  361 bits (927), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 186/322 (57%), Positives = 234/322 (72%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G+G  LP+RV+ NS+ E  +DT+D WI+ R GI RRH A  DETT+ L   AA  
Sbjct: 4   RSVVVGVGHYLPKRVVPNSEFEKTLDTTDEWIRTRSGIERRHFAADDETTSDLAAKAAEA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A ++ DDID I++ATST D TFPS A  +Q RLGM RGFAFD+QAVC+GFVYA++ 
Sbjct: 64  ALADAGLTADDIDAIVLATSTADLTFPSAATMVQARLGMNRGFAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ + SG  RRV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LEG E +G+S  D GI
Sbjct: 124 ANALVLSGQARRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVLEGQEGQGTS-DDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK  +  E   +   LT 
Sbjct: 183 LATDLNSDGRYKDLLYVDGGVSTQST-GHLRMQGNQVFRHAVEKLAKTAEVALERAGLTT 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           +++DW VPHQAN RII     KM +P D V+VTV  HGNTSAASIPLAL+V  + G++K+
Sbjct: 242 DDVDWIVPHQANIRIIQGTARKMGLPMDNVVVTVQDHGNTSAASIPLALSVGKQSGQIKQ 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G V LRW
Sbjct: 302 GDLIVTEAIGGGLAWGAVALRW 323


>gi|254477647|ref|ZP_05091033.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ruegeria sp. R11]
 gi|214031890|gb|EEB72725.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ruegeria sp. R11]
          Length = 323

 Score =  361 bits (927), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 233/322 (72%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ + GIG  LP R++ N++ E+ +DTSD WI+ R GI RRH A + ETT+++   AA++
Sbjct: 4   RAVIAGIGHYLPERIVENAEFEATLDTSDEWIRSRSGIERRHFAAEGETTSNMATKAAQN 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A M+ DDID I+VATST D TFPS A  +Q +LGM +GFAFD+QAVC+GFVYA++ 
Sbjct: 64  ALADAGMTADDIDAIVVATSTADLTFPSAATMVQAQLGMTKGFAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ + SG   +V+VIG++TFS+I+DW+DRSTCVLFGDGAGAL+LE  E  G+S  D GI
Sbjct: 124 ANALVASGQADKVLVIGAETFSKIMDWTDRSTCVLFGDGAGALVLEAQEGAGTS-DDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L SDG + D LYVDGG ST  T G +RM+G  VF++AVEK         +   L  
Sbjct: 183 LATDLNSDGRFKDLLYVDGGVSTQNT-GHLRMQGNQVFRHAVEKLASTAHTSLERAGLGA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           +++DW VPHQAN RII     KM +P DKV+VTV  HGNTSAASIPLAL+V    G++K+
Sbjct: 242 DDVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDHGNTSAASIPLALSVGKARGQIKQ 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G+V+LRW
Sbjct: 302 GDLIVTEAIGGGLAWGSVVLRW 323


>gi|294083742|ref|YP_003550499.1| putative 3-oxoacyl-acyl-carrier-protein synthase iii [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663314|gb|ADE38415.1| probable 3-oxoacyl-acyl-carrier-protein synthase iii [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 327

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 171/316 (54%), Positives = 240/316 (75%), Gaps = 4/316 (1%)

Query: 9   IGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAE 68
           +G  LP +V+SN +L + VDTSD WI+RR GI++RH+ G++E T+ L   A+++AL HA 
Sbjct: 11  VGSYLPEKVVSNKELSTYVDTSDEWIRRRTGITQRHVVGENEKTSDLARKASQEALEHAG 70

Query: 69  MSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIR 128
           ++  DIDLIIVATSTPD TFPS A  +Q ++G     AFD+QAVC+GF+YA+  AD+ ++
Sbjct: 71  LTGADIDLIIVATSTPDDTFPSNATKLQYQIGATTAIAFDIQAVCAGFIYALDVADAMLQ 130

Query: 129 SGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLC 188
           SG  +R +V+G+++FS+I+DW DRSTCVLFGDGAGA++LE +E   S + D GI S+ L 
Sbjct: 131 SGRGKRALVVGAESFSKILDWKDRSTCVLFGDGAGAVVLE-IE---SDVGDFGIKSSILH 186

Query: 189 SDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWF 248
           +DG+Y D LYVDGGPS++  VG +RMEGK VF++AVEK   ++++V ++ ++T  ++DW 
Sbjct: 187 ADGNYRDILYVDGGPSSTNDVGHVRMEGKEVFRHAVEKLSAVMDEVLEAANMTAADVDWL 246

Query: 249 VPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLL 308
           VPHQAN RII+S+  KMK+P D+V+ TVD H NTSAASIPLALA AV++GR+K G  L L
Sbjct: 247 VPHQANIRIIDSMQRKMKLPQDRVVRTVDRHANTSAASIPLALADAVRDGRIKNGHVLAL 306

Query: 309 EAMGGGFTSGTVLLRW 324
           EA+GGG   G  L+++
Sbjct: 307 EAIGGGLVWGAALVKY 322


>gi|144899187|emb|CAM76051.1| beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 324

 Score =  360 bits (925), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 235/323 (72%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS + G G  LP R+++N++L S VDTSD WI  R GI +RHIA   ETT+ L   AA
Sbjct: 2   ILRSQIVGSGSYLPSRIVTNAELASKVDTSDDWIVERTGIRQRHIAADGETTSDLATIAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +   D+DL+IVAT+TPD TFP+TA  +Q+RLGM  G AFDMQAVCSGF++A+
Sbjct: 62  ERALASAGLKGSDVDLLIVATATPDNTFPATATKVQSRLGMTGGAAFDMQAVCSGFIFAM 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD++I++   R  +VIG++TFSRI+DW DR TCVLFGDGAGA++L G   KG +  D 
Sbjct: 122 ATADNFIKAEQARTALVIGAETFSRILDWEDRGTCVLFGDGAGAMVLRGSWEKGGNQ-DR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST+L SDG +   L+VDGGPS+++TVG +RMEGK VF++AV    +++ +   +  L
Sbjct: 181 GILSTHLHSDGRHYGLLHVDGGPSSTQTVGHLRMEGKEVFRHAVTNLAQVVGEALRANDL 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +  +IDW VPHQAN RI+ S   K+ +  D+++VTVD H NTSAASIPLA   AV +GR+
Sbjct: 241 SAADIDWVVPHQANRRILESTAKKLGLSMDRMVVTVDQHANTSAASIPLAFHSAVSDGRL 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
            KGD +++EAMGGGFT G+ L+R
Sbjct: 301 NKGDLVVMEAMGGGFTWGSALVR 323


>gi|85374551|ref|YP_458613.1| 3-oxoacyl-acyl-carrier-protein synthase III [Erythrobacter
           litoralis HTCC2594]
 gi|122544109|sp|Q2N925|FABH_ERYLH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|84787634|gb|ABC63816.1| probable 3-oxoacyl-acyl-carrier-protein synthase iii [Erythrobacter
           litoralis HTCC2594]
          Length = 321

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 171/324 (52%), Positives = 243/324 (75%), Gaps = 3/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR+ ++G G +LPR+V++N +L + VDTSD WI  R GI +R+IAG DE T++L   A+
Sbjct: 1   MIRAAIKGSGSALPRKVVTNEELAARVDTSDEWIVERTGIRQRYIAGADEFTSTLAMEAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A ++ + IDLI++AT+TPD TFP+TA  +Q  LG     AFD+QAVCSGF+YA+
Sbjct: 61  RKALEAAGITPETIDLIVLATATPDNTFPATATKVQEALGCNGCIAFDVQAVCSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TADS +++G+ +R +VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  E  G + A  
Sbjct: 121 ATADSLLKTGMAKRALVIGAETFSRILDWEDRTTCVLFGDGAGAVVLEAAE--GDTEA-P 177

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL++ L +DG+  D LYVDGGPST++TVG +RM G+ VF++AV    +++++V D   +
Sbjct: 178 GILASRLHADGAQHDLLYVDGGPSTTQTVGHLRMRGREVFRHAVVNLADVLKEVLDDAGV 237

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +  +IDW VPHQAN RI+++   K+ +P +K++VTVD H NTSAAS+PLA   AV++GR+
Sbjct: 238 SASDIDWVVPHQANARILDATARKLGLPMEKIVVTVDRHANTSAASVPLAFDTAVRDGRI 297

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K GD ++ EAMGGGFT G  L+R+
Sbjct: 298 KPGDLVMFEAMGGGFTWGASLVRY 321


>gi|149202719|ref|ZP_01879691.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius sp.
           TM1035]
 gi|149144001|gb|EDM32035.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius sp.
           TM1035]
          Length = 324

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 232/323 (71%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V+GIG  LP R++ N++ E+ +DTSD WI+ R GI RRH A KD+ T+ L   AAR
Sbjct: 3   LRAVVQGIGHYLPERIVPNAEFEATLDTSDEWIRTRSGIERRHFAAKDQPTSDLAVRAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL HA ++ DDID I+VATSTPD TFPS A  +Q+ LGM RGF FD+QAVC+GF+YA+T
Sbjct: 63  AALEHAGLTPDDIDGIVVATSTPDLTFPSVATMVQSELGMTRGFGFDVQAVCAGFIYALT 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TA++ + SG  +RV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+L G+E    +  D G
Sbjct: 123 TANALLLSGQAQRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVL-GLEEGAGTSEDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS  L SDG Y D LYVDGG ST+   G +RM+G  +F+ AVEK     E       L+
Sbjct: 182 ILSADLNSDGRYRDMLYVDGGVSTTGEAGKLRMQGNPLFRQAVEKLASTAETALAKIGLS 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     K+ +P ++VIVTV  HGNTSAASIPLAL+V V  G++K
Sbjct: 242 GSDVDWIVPHQANIRIIQGTAKKLGLPMERVIVTVQDHGNTSAASIPLALSVGVASGKIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD LL EA+GGG   G V LRW
Sbjct: 302 RGDLLLAEAIGGGLAWGAVALRW 324


>gi|221639023|ref|YP_002525285.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter
           sphaeroides KD131]
 gi|221159804|gb|ACM00784.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter
           sphaeroides KD131]
          Length = 318

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 184/319 (57%), Positives = 237/319 (74%), Gaps = 2/319 (0%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           VRG+G  LP RV+ NS+LE+IV+T+D WI+ R GI RRH A + +TT+ L   AAR AL 
Sbjct: 2   VRGVGHYLPDRVVPNSELEAIVETTDEWIRTRSGIERRHFAAEGQTTSDLAARAARAALE 61

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +  DDID +IVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFVYA+  AD+
Sbjct: 62  DAGLQPDDIDTLIVATSTADLTFPSAATMVQAALGMTRGFAFDVQAVCAGFVYALANADA 121

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
            IRSG  +RV+VIG++TFSR++DW+DR+TCVLFGDGAGA++LEG E  G+S AD GIL+T
Sbjct: 122 LIRSGQAQRVLVIGAETFSRLMDWNDRATCVLFGDGAGAVVLEGTESAGTS-ADRGILAT 180

Query: 186 YLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENI 245
            L SDG + D LYVDGG ST  T G +RM+G+ VF++AVEK  E      +   L   ++
Sbjct: 181 DLHSDGRFKDLLYVDGGSSTG-TTGHLRMQGREVFRHAVEKLAETAHTALEKAGLGAGDV 239

Query: 246 DWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDC 305
           DW VPHQAN RII++   +M++P D+VI+TV  HGNTSAASIPLAL+V    G++K+GD 
Sbjct: 240 DWIVPHQANLRIISATAQRMQVPMDRVILTVQDHGNTSAASIPLALSVGKARGQIKEGDL 299

Query: 306 LLLEAMGGGFTSGTVLLRW 324
           L+ EA+GGG   G+V+LRW
Sbjct: 300 LVTEAIGGGLAWGSVVLRW 318


>gi|89054275|ref|YP_509726.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Jannaschia sp. CCS1]
 gi|122498859|sp|Q28RG1|FABH_JANSC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|88863824|gb|ABD54701.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Jannaschia sp. CCS1]
          Length = 326

 Score =  359 bits (922), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 237/326 (72%), Gaps = 3/326 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           +IR+   GIG  LP RV+ N++ E++  ++TSD WI+ R GI RRH A + ETT+ +   
Sbjct: 2   IIRAVPVGIGHYLPERVVPNAEFEAMEGLETSDEWIRARSGIERRHFAAEGETTSQMAVT 61

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL HA ++ DDID +IVATSTPD TFPS A  +Q  LGM  GFAFD+QAVC+GFVY
Sbjct: 62  AARKALDHAALNPDDIDAVIVATSTPDLTFPSVATMVQAGLGMTGGFAFDVQAVCAGFVY 121

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+  A++ I SG   RV+VIG++TFSRI+DW+DR+TCVLFGDGAGALILEG +  G+   
Sbjct: 122 ALANANALIVSGQANRVLVIGAETFSRIMDWTDRTTCVLFGDGAGALILEGRDSAGTPQ- 180

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           D GILST L SDG++ + LYVDGG S++ T G ++M+GK VF++A+EK  +  +      
Sbjct: 181 DRGILSTDLHSDGTHRELLYVDGGVSSTGTTGVLKMQGKEVFRHAIEKLTKTADTGLAKA 240

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +T+ ++DW VPHQAN RII+  V K  +P DKVIVTV  HGNTSAASIPLA++V V +G
Sbjct: 241 GVTVGDVDWVVPHQANIRIISGTVKKFGLPMDKVIVTVQDHGNTSAASIPLAMSVGVGDG 300

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R++ G  L+ EA+GGG   G V++RW
Sbjct: 301 RIQPGHLLVTEAIGGGLAWGAVVMRW 326


>gi|99080755|ref|YP_612909.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ruegeria sp. TM1040]
 gi|123379017|sp|Q1GI69|FABH_SILST RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|99037035|gb|ABF63647.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ruegeria sp. TM1040]
          Length = 323

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 229/322 (71%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G G  LP R++ N++ E+ +DTSD WI+ R GI RRH A + ETT+ +   AA  
Sbjct: 4   RAVVIGAGHYLPDRIVENAEFEATLDTSDEWIRSRSGIERRHFAAEGETTSHMATRAAEA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  S DD+D I++ATST D TFPS A  +Q++LGM +GFAFD+QAVC+GFVYA++ 
Sbjct: 64  ALKSAGRSADDVDAIVLATSTADLTFPSAATMVQSQLGMTKGFAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  E +G+S  D GI
Sbjct: 124 ANALIASGQADRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALLLEAQEGEGTSK-DRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         +    + 
Sbjct: 183 LATDLNSDGRYKDLLYVDGGVSTQST-GYLRMQGNQVFRHAVEKLASTAHTALERAGAST 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           + +DW VPHQAN RII     KM +P DKV+VTV  HGNTSAASIPLAL+V V+ G++K 
Sbjct: 242 DEVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDHGNTSAASIPLALSVGVERGQIKP 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G V+LRW
Sbjct: 302 GDLIVTEAIGGGLAWGAVVLRW 323


>gi|260433447|ref|ZP_05787418.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260417275|gb|EEX10534.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 323

 Score =  358 bits (920), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 179/322 (55%), Positives = 230/322 (71%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G+G  LP+RV+ NS+ E  +DT+D WI+ R GI RRH A  DE T+ L   AA  
Sbjct: 4   RSVVVGVGHYLPKRVVPNSEFEKTLDTTDEWIRTRSGIERRHFAADDEATSDLATRAAEA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +  +DID I++ATST D TFP+ A  +Q  LGM RGFAFD+QAVC+GFV+A++ 
Sbjct: 64  ALKDAGLDANDIDAIVLATSTADLTFPAAATMVQANLGMTRGFAFDVQAVCAGFVFALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG  RRV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  +  G+  AD GI
Sbjct: 124 ANALILSGQARRVLVIGAETFSRILDWTDRSTCVLFGDGAGALVLEAQDGVGTP-ADRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST L SDG + D LYVDGG ST +T G +RM+G  VF++AVEK         D   LT 
Sbjct: 183 LSTDLHSDGRHKDLLYVDGGVST-QTTGHLRMQGNQVFRHAVEKLAATATTALDRAGLTS 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII     K+++P D V+VTV  HGNTSAASIPLAL+V  + G++K+
Sbjct: 242 GDVDWIVPHQANIRIIQGTAKKLQLPMDNVVVTVQDHGNTSAASIPLALSVGKERGQIKQ 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G+V+LRW
Sbjct: 302 GDLIVTEAIGGGLAWGSVVLRW 323


>gi|254293750|ref|YP_003059773.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hirschia baltica
           ATCC 49814]
 gi|254042281|gb|ACT59076.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hirschia baltica
           ATCC 49814]
          Length = 328

 Score =  358 bits (919), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 232/321 (72%), Gaps = 2/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V GIG  LP RVL+N DL  +VDT D WI  R GI  RHIA  D+ T+ LG  AA  
Sbjct: 9   RSVVTGIGGYLPERVLTNEDLSKMVDTDDQWITERTGIKSRHIAADDQLTSDLGVHAAHA 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           A+  A +SVDDIDLII AT+TPD+TFP+TA  IQ +LG+  G AFD+QAVCSGFV+A+ T
Sbjct: 69  AMKDAGVSVDDIDLIICATATPDKTFPATAAIIQAKLGVTNGAAFDVQAVCSGFVFAMAT 128

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+Y+  G  +R +VIG++TFSRI+DWSDR TCVLFGDGAGA++LE          ++G+
Sbjct: 129 ADNYLARGQFKRALVIGAETFSRIIDWSDRGTCVLFGDGAGAVVLE--RQDPDEAGESGV 186

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L  +L +DG Y+D L+VDGGPS+++TVG +RM G  VFK+AV K  E + +V + T + +
Sbjct: 187 LGAHLRTDGRYVDLLHVDGGPSSTQTVGHLRMVGNQVFKHAVNKISESVRQVVEDTDIGL 246

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ENIDW VPHQAN RI++++   + I  ++++ TVD HGNTSAAS+PLAL+   + G++ K
Sbjct: 247 ENIDWIVPHQANQRILSAVARNLGIEENRIVSTVDRHGNTSAASVPLALSELNRSGKLNK 306

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L+EA+GGG + G  L R
Sbjct: 307 GDLVLIEAIGGGLSWGAALFR 327


>gi|85703261|ref|ZP_01034365.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius sp. 217]
 gi|85672189|gb|EAQ27046.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius sp. 217]
          Length = 324

 Score =  358 bits (918), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 230/323 (71%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS V+GIG  LP R++ NS+ E  ++TSD WI+ R GI RRH A   + T+ L   AAR
Sbjct: 3   LRSVVQGIGHYLPDRIVPNSEFEKTLETSDEWIRTRSGIERRHFAADGQPTSDLAVRAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL +A +  DDID I+VATSTPD TFPS A  +Q  LGM RGF FD+QAVC+GF+YA+T
Sbjct: 63  AALTNAGLVADDIDGIVVATSTPDLTFPSVATMVQKELGMTRGFGFDIQAVCAGFIYALT 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TA++ I SG  +RV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+L   E  G+S AD G
Sbjct: 123 TANALILSGQAQRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVLAAEEGTGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS+ L SDG Y D LYVDGG ST+   G +RM+G  +F+ AVEK     E   +   LT
Sbjct: 182 ILSSDLNSDGRYRDMLYVDGGVSTTGEAGKLRMQGNPLFRQAVEKLASTAEAALEKIGLT 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     K+ +P D+VIVTV  HGNTSAASIPLAL+V V  G++K
Sbjct: 242 GADVDWIVPHQANIRIIQGTAKKLGLPMDRVIVTVQDHGNTSAASIPLALSVGVASGKIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD LL EA+GGG   G V LRW
Sbjct: 302 QGDLLLAEAIGGGLAWGAVALRW 324


>gi|119384598|ref|YP_915654.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paracoccus
           denitrificans PD1222]
 gi|166971559|sp|A1B364|FABH_PARDP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|119374365|gb|ABL69958.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Paracoccus
           denitrificans PD1222]
          Length = 323

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 234/324 (72%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ VRG G  LP RV+ NS  E  +DTSD WI+ R GI RRH A +D+ T+ LG  AA
Sbjct: 1   MRRAIVRGTGHYLPERVVENSWFEDKLDTSDEWIRARTGIERRHFAAEDQRTSDLGILAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +    ID +IVATSTPD TFPS A  +Q  LGM+ GFA+D+QAVC+GFVYA+
Sbjct: 61  QAALADAGLEAAQIDAVIVATSTPDLTFPSVATMVQAGLGMRHGFAYDLQAVCAGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD+ IR+G+  RV++IG++TFSRI+DW+DR TCVLFGDGAGA++LE  E +GSS AD 
Sbjct: 121 ANADALIRAGLADRVLLIGAETFSRIMDWTDRGTCVLFGDGAGAVVLEAAEGQGSS-ADR 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T L SDG Y D LYVDGG +++ T G +RM+G  VF++AVEK  +   +  D   L
Sbjct: 180 GILATDLNSDGQYRDLLYVDGGVASTGTAGHLRMQGNLVFRHAVEKLADTAHRALDRAGL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T + +DW VPHQAN RII +   +M +P +KV++TV  HGNTSAASIPLAL+VA  EGR 
Sbjct: 240 TPDQVDWLVPHQANLRIIEATAKRMHLPMEKVVLTVADHGNTSAASIPLALSVANAEGRF 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K GD L+ EA+GGG   G+V+LRW
Sbjct: 300 KPGDLLVAEAIGGGLAWGSVVLRW 323


>gi|163739612|ref|ZP_02147021.1| 2'-deoxycytidine 5'-triphosphate deaminase [Phaeobacter
           gallaeciensis BS107]
 gi|161387071|gb|EDQ11431.1| 2'-deoxycytidine 5'-triphosphate deaminase [Phaeobacter
           gallaeciensis BS107]
          Length = 323

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 230/322 (71%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ + G G  LP RV+ N++ E+ +DT+D WI+ R GI RRH A + ETT+ +   AA++
Sbjct: 4   RAVIVGTGHYLPERVVENAEFEATLDTTDEWIRSRSGIERRHFAAEGETTSMMATKAAQN 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A M+ +DID I+VATST D TFPS A  +Q +LGM RGFAFD+QAVC+GFVYA++ 
Sbjct: 64  ALADAGMTAEDIDAIVVATSTADLTFPSAATMVQAQLGMTRGFAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ + SG   +V+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  +  G+S  D GI
Sbjct: 124 ANALVASGQASKVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVLEAQDSAGTS-DDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         +   L  
Sbjct: 183 LATDLNSDGRYKDLLYVDGGVSTQNT-GHLRMQGNQVFRHAVEKLASTAHTALERAGLGA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII     KM +P +KV+VTV  HGNTSAASIPLAL+V    G++K+
Sbjct: 242 SDVDWIVPHQANIRIIQGTAKKMGLPMEKVVVTVQDHGNTSAASIPLALSVGKARGQIKQ 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G+V+LRW
Sbjct: 302 GDLVVTEAIGGGLAWGSVVLRW 323


>gi|114570073|ref|YP_756753.1| 3-oxoacyl-(acyl carrier protein) synthase III [Maricaulis maris
           MCS10]
 gi|114340535|gb|ABI65815.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Maricaulis maris
           MCS10]
          Length = 326

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 232/323 (71%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + GIG  LP R+L+N ++ ++VDTSD WI+ R GI +RHIAG+  TT  L E AAR
Sbjct: 4   LSARIAGIGSHLPERILNNDEISAMVDTSDSWIRERTGIRQRHIAGEGVTTCDLAERAAR 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++ +++DLI+VAT+TPD TFPS    +Q RLG  +G AFD+QAVC+GFVYA++
Sbjct: 64  RALEDAGIAAEELDLIVVATTTPDFTFPSVGTMLQARLGATQGAAFDVQAVCTGFVYALS 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD+ I  G  +  +V+G++T SRI+DW+DRSTCVLFGDGAGA++L+  E  G     +G
Sbjct: 124 MADNMIARGQAKTALVVGAETMSRILDWTDRSTCVLFGDGAGAMVLQAAEPAGEGTDRSG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL TYL SDG + D L+VDGGPS++ TVG +RM G  VF++A+    E +  +     +T
Sbjct: 184 ILGTYLRSDGRFKDLLHVDGGPSSTGTVGHLRMVGNQVFRHAITNIAESMTTIASRCGVT 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
           IE +DWFVPHQAN RI+  +  ++ IP +KVI TV  HGNTSAAS+PLA   AV++GR+K
Sbjct: 244 IEEVDWFVPHQANQRILEGVARRLSIPTEKVISTVADHGNTSAASVPLAFDRAVQDGRIK 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +L+EA+GGGFT G  L R+
Sbjct: 304 RGDLVLMEALGGGFTWGAALARY 326


>gi|170750365|ref|YP_001756625.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656887|gb|ACB25942.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           radiotolerans JCM 2831]
          Length = 335

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 243/323 (75%), Gaps = 4/323 (1%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS V G G SLP RV++N+DL   VDTSD WI +R GI +RH+AG DETT+ LG  AAR
Sbjct: 17  LRSVVVGTGSSLPARVVTNADLAERVDTSDEWIVQRTGIRQRHLAGPDETTSVLGTRAAR 76

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++ DDIDL+I ATSTPD TFP+TA  IQ  LG+ +G AFD+QAVC+GFV+AV+
Sbjct: 77  AALDDAGLTADDIDLVICATSTPDHTFPATATQIQAALGIHQGAAFDLQAVCAGFVFAVS 136

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  RR +VIG++TFSRIVDW DR+TCVLFGDGAGA++LE  E  G    D G
Sbjct: 137 TADKFLTTGAARRALVIGAETFSRIVDWEDRTTCVLFGDGAGAVVLEAQEGAG----DRG 192

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS  L SDG + +KLYVDGGP ++ T G +RMEG+ VF++AV +  ++I + F    +T
Sbjct: 193 VLSASLRSDGRHREKLYVDGGPGSTGTTGHLRMEGRDVFRFAVGQVTDVIVEAFAQAGIT 252

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E +DWFVPHQAN RII +  DK+ +  DK+++TVD HGNTSAASIPLAL VA ++GR++
Sbjct: 253 AEELDWFVPHQANRRIIEASADKLGVARDKIVLTVDRHGNTSAASIPLALDVARRDGRIR 312

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD +++EA+GGGF+ G  L+RW
Sbjct: 313 AGDLVMIEAIGGGFSWGAALIRW 335


>gi|114762843|ref|ZP_01442275.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pelagibaca
           bermudensis HTCC2601]
 gi|114544453|gb|EAU47460.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius sp.
           HTCC2601]
          Length = 323

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 187/323 (57%), Positives = 228/323 (70%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ V G+G  LP R++ N++ E  +DTSD WI+ R GI RRH A   ETT+ L   AA+
Sbjct: 3   IRAQVAGVGHYLPERIVPNAEFEQTLDTSDEWIRTRSGIERRHFAADGETTSDLASRAAQ 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DID +IVATSTPD TFPS A  +Q +LGM+ GFAFD+QAVC+GFVYA+T
Sbjct: 63  AALADAGLVAADIDALIVATSTPDLTFPSAATMVQAKLGMQAGFAFDVQAVCAGFVYALT 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG VRRVMVIG++TFSRI+DW DR+TCVLFGDGAGALILE  E  GSS  D G
Sbjct: 123 NANALITSGTVRRVMVIGAETFSRILDWEDRATCVLFGDGAGALILEAQEAAGSS-DDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+  L SDG Y D LYVDGG ST+ ++G +RMEGK VF++AV K     E       L 
Sbjct: 182 ILAVDLHSDGRYRDLLYVDGGVSTN-SIGHLRMEGKEVFRHAVSKLAATAEAALGKAGLD 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW VPHQAN RII     K+ +P +KV+VTV  HGNTSAASIPLAL+VA  EG+ K
Sbjct: 241 ASDIDWVVPHQANIRIIAGTAKKLGLPMEKVVVTVQDHGNTSAASIPLALSVANSEGKFK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD ++ EA+GGG   G V LRW
Sbjct: 301 PGDLVITEAIGGGLAWGAVALRW 323


>gi|159044269|ref|YP_001533063.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Dinoroseobacter shibae
           DFL 12]
 gi|189037892|sp|A8LLT4|FABH_DINSH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157912029|gb|ABV93462.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Dinoroseobacter shibae
           DFL 12]
          Length = 324

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 236/322 (73%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G+G  LP RV+ NS+LE++VDT+D WI+ R GI RRH A   E T+ L  AAA+ 
Sbjct: 4   RAVVTGVGHYLPSRVVPNSELETLVDTTDEWIRTRSGIERRHFAADGEQTSDLATAAAQA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL HAE++  D+D +IVATSTPD TFP+ A  +Q RLGM RGFA+D+QAVC+GFV+A+  
Sbjct: 64  ALDHAELTAQDVDAVIVATSTPDLTFPAVATMVQARLGMTRGFAYDVQAVCAGFVFAMAN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   R++VIG++TFSRI+DW+DRSTCVLFGDGAGA++LE  +  G + AD GI
Sbjct: 124 ANAMILSGQADRILVIGAETFSRIMDWTDRSTCVLFGDGAGAVVLEARDGTGGT-ADRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LS  L SDG + D LYVDGG S+S+T G +RMEGK VF++A+EK     E       LT 
Sbjct: 183 LSADLNSDGRHRDILYVDGGVSSSQTAGYLRMEGKEVFRHAIEKLAATAETALAKAGLTE 242

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII +   KM I  D+V+VTV  HGNTSAASIP+AL+V V  G++K 
Sbjct: 243 ADVDWVVPHQANLRIITATARKMGIGMDRVVVTVADHGNTSAASIPMALSVGVARGQIKP 302

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG + G+V+LRW
Sbjct: 303 GDLVVTEAIGGGLSWGSVVLRW 324


>gi|254453296|ref|ZP_05066733.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Octadecabacter
           antarcticus 238]
 gi|198267702|gb|EDY91972.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Octadecabacter
           antarcticus 238]
          Length = 323

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 229/323 (70%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ NS+ E+ +DT+D WIK R GI RRH A   +TT+ L   AA+
Sbjct: 3   IRAIVRGVGHYLPDRVVPNSEFEATLDTTDAWIKARSGIERRHFAATGQTTSDLATRAAK 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           DAL  A M   DID II+ATST D TFPS+A  +Q  +G   G+AFD+QAVC+GFV+A+ 
Sbjct: 63  DALSDAGMDGSDIDTIILATSTADLTFPSSATMVQRNIGNTTGYAFDIQAVCAGFVFALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  +RV+VIG++TFSRI+DW+DR TCVLFGDGAGA++LE  +    +  D G
Sbjct: 123 NANALIISGQAKRVLVIGAETFSRIMDWTDRGTCVLFGDGAGAMVLEAAQ-SADNPDDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG+Y D LYVDGG ST  T G +RM+GK VF++AVEK             L 
Sbjct: 182 ILATDLNSDGTYCDLLYVDGGVSTQNT-GMLRMQGKEVFRHAVEKLASTATTALQKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DW VPHQAN RII S   K+ +P ++V+VTV  HGNTSAASIPLAL+V V+ G++K
Sbjct: 241 HEDVDWVVPHQANIRIIQSTAKKLGVPMERVVVTVQDHGNTSAASIPLALSVGVQRGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++ EA+GGG   G V+LRW
Sbjct: 301 RGDLVVTEAIGGGLAWGAVVLRW 323


>gi|148556458|ref|YP_001264040.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sphingomonas
           wittichii RW1]
 gi|254783825|sp|A5VC86|FABH_SPHWW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|148501648|gb|ABQ69902.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sphingomonas
           wittichii RW1]
          Length = 319

 Score =  355 bits (911), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 236/324 (72%), Gaps = 5/324 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ V G G +LPRR +SN++L   VDTSD WI  R GI  R++AG+ ETT++L   AA
Sbjct: 1   MRRAVVIGTGSALPRRQVSNAELARTVDTSDEWIVERTGIRNRYVAGEGETTSTLATEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A ++  DI LII+AT+TPDQTFP++A  +Q  LG+    AFD+QAVCSGF+YA+
Sbjct: 61  RKAIEAAGIAPSDIGLIILATATPDQTFPASATMVQAALGIGDCVAFDVQAVCSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + ADS IR G     +VIG++TFSRI+DW DR+TCVLFGDGAGA++L     K     D 
Sbjct: 121 SVADSMIRGGSATHALVIGAETFSRILDWEDRTTCVLFGDGAGAVVL-----KAEEGGDR 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L+T L +DG +   LYVDGGPST++TVG +RM+G+ VF++AV    +++ +V     L
Sbjct: 176 GVLATRLHADGRHNQLLYVDGGPSTTQTVGKLRMKGQEVFRHAVTNLAQVLREVMGDAGL 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T+++IDW VPHQAN RI+++   K+ +P ++VIVTVD H NTSAAS+PLAL VAV++GR+
Sbjct: 236 TVDDIDWVVPHQANRRILDATARKLGLPAERVIVTVDQHANTSAASVPLALDVAVRDGRI 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K GD L+LEAMGGGFT G   +R+
Sbjct: 296 KPGDLLVLEAMGGGFTWGAAAIRY 319


>gi|103486904|ref|YP_616465.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sphingopyxis
           alaskensis RB2256]
 gi|123379856|sp|Q1GT90|FABH_SPHAL RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|98976981|gb|ABF53132.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sphingopyxis
           alaskensis RB2256]
          Length = 321

 Score =  355 bits (910), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 234/321 (72%), Gaps = 4/321 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ ++G G +LPR  +SN++L   VDTSD WI  R GI  RHIA  DETTA+LG  AAR 
Sbjct: 4   RAILKGTGSALPRTRVSNAELAERVDTSDEWIVERTGIRFRHIAEPDETTATLGADAARR 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +   DI LIIVAT+TPD TFP++A  +Q  LG     AFD+ AVCSGF+YAV+ 
Sbjct: 64  ALEAAGLQPADIGLIIVATATPDNTFPASATKVQALLGAPDCIAFDVAAVCSGFLYAVSV 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+ +R+G  R  +VIGS+TFSRI+DW+DR+TCVLFGDGAGA++L   +V      D G+
Sbjct: 124 ADAMLRTGAARHALVIGSETFSRILDWNDRTTCVLFGDGAGAVVLSAEDVAD----DRGV 179

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L ++G Y D LYVDGGPST+ TVG +RM+G+ VF++AV     ++ +V     L+ 
Sbjct: 180 LATRLHAEGRYCDMLYVDGGPSTTGTVGHVRMQGREVFRHAVTNLAAVLGEVMRDVGLSA 239

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++IDW VPHQAN RII++   K+ +P D+V++TVD H NTSAAS+PLAL +AV++GR+K+
Sbjct: 240 DDIDWVVPHQANKRIIDATAKKLGLPADRVVLTVDQHANTSAASVPLALDLAVRDGRIKR 299

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD ++LEAMGGGFT G  +LR
Sbjct: 300 GDLVVLEAMGGGFTWGAAVLR 320


>gi|259419119|ref|ZP_05743036.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Silicibacter sp.
           TrichCH4B]
 gi|259345341|gb|EEW57195.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Silicibacter sp.
           TrichCH4B]
          Length = 323

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 174/322 (54%), Positives = 228/322 (70%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G G  LP R++ N++ E+ ++TSD WI+ R GI RRH A + ETT+ +   AA  
Sbjct: 4   RAVVIGAGHYLPERIVENAEFEATLETSDEWIRSRSGIERRHFAAEGETTSQMATRAAEA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  + +D+D I++ATST D TFPS A  +Q++LGM +GFAFD+QAVC+GFVYA++ 
Sbjct: 64  ALKSAGRTAEDVDAIVLATSTADLTFPSAATMVQSQLGMTKGFAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIG++TFSRI+DWSDRSTCVLFGDGAGAL+LE  E  G+   D GI
Sbjct: 124 ANALIASGQADRVLVIGAETFSRIMDWSDRSTCVLFGDGAGALLLEAQEGAGTP-EDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L+T L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         +    + 
Sbjct: 183 LATDLNSDGRYKDLLYVDGGVSTQST-GHLRMQGNQVFRHAVEKLASTATTALERAGAST 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           +++DW VPHQAN RII     KM +P DKV+VTV  HGNTSAASIPLAL+V V+ G++K 
Sbjct: 242 DDVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDHGNTSAASIPLALSVGVERGQIKP 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G+ ++ EA+GGG   G V+LRW
Sbjct: 302 GNLIVTEAIGGGLAWGAVVLRW 323


>gi|188581268|ref|YP_001924713.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           populi BJ001]
 gi|179344766|gb|ACB80178.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           populi BJ001]
          Length = 326

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 244/323 (75%), Gaps = 2/323 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           RS V G G  LP  V++N+DL E  ++TSD WI +R GI +RHIA  DETT+ LG  AAR
Sbjct: 5   RSVVVGCGAYLPETVVTNTDLAERGIETSDEWIVQRTGIRQRHIARPDETTSVLGTRAAR 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DIDL+I ATSTPD TFPSTA  IQ  LG++ GFAFD+QAVC+GFVYAV 
Sbjct: 65  AALDEAGLSPADIDLVICATSTPDHTFPSTATQIQAALGIEGGFAFDLQAVCAGFVYAVA 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  +R +VIG++TFSR++DW DR+TCVLFGDGAGA++LE  + +G++ AD G
Sbjct: 125 TADRFLATGGAKRALVIGAETFSRLLDWEDRTTCVLFGDGAGAIVLEARDGEGTN-ADRG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L++ L SDG +  KLYVDGGP ++ T G +RMEG+ VF++AV    ++IE+ F ++  T
Sbjct: 184 VLASCLRSDGRHRAKLYVDGGPGSTGTTGKLRMEGREVFRFAVGSVTDVIEETFRASGTT 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++ WFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR++
Sbjct: 244 ADDLAWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAARRDGRIR 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGFT G  LLRW
Sbjct: 304 EGDLVMIEAIGGGFTWGAALLRW 326


>gi|258542775|ref|YP_003188208.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633853|dbj|BAH99828.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636912|dbj|BAI02881.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639965|dbj|BAI05927.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643021|dbj|BAI08976.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646076|dbj|BAI12024.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649129|dbj|BAI15070.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652116|dbj|BAI18050.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655173|dbj|BAI21100.1| 3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 326

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 234/321 (72%), Gaps = 4/321 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G  LP RV+SN++L   ++TSD WIK R GI+RRH+ G ++T AS+G  AAR 
Sbjct: 9   RSLLVGFGGFLPDRVVSNAELAERLETSDEWIKTRTGITRRHLVGPNDTAASMGAEAARR 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A ++ DDID + VAT+TPDQ FP+TAV +Q  LGMK+GF FD+ A CSGF++A++T
Sbjct: 69  ALDYAGLTADDIDAVFVATATPDQAFPATAVRVQAALGMKQGFGFDITAACSGFIFALST 128

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD++IRSG +R  +VIGS+ +SRI+DW DR+TCVLFGDGAGA++L   +  G    D GI
Sbjct: 129 ADAFIRSGQIRNALVIGSEVYSRIMDWEDRTTCVLFGDGAGAVVLSASDEPG----DRGI 184

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST+L SDG+  D LYVDG        G ++M G+ VF++AV K    +++  ++  L+ 
Sbjct: 185 LSTHLHSDGTAGDLLYVDGAVGQPDKSGHLKMSGRDVFRHAVGKLSSSVDEALEAEGLSY 244

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII  +  K+ +P ++V+VTVD H NTSAAS+PLAL  AV++GR++K
Sbjct: 245 ADVDWLVPHQANIRIIEGVAKKLNLPAERVVVTVDRHANTSAASVPLALDEAVRDGRIQK 304

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L+EA+GGG T G+ L+R
Sbjct: 305 GDLVLMEALGGGLTWGSALVR 325


>gi|114798802|ref|YP_759881.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hyphomonas neptunium
           ATCC 15444]
 gi|123128962|sp|Q0C312|FABH_HYPNA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|114738976|gb|ABI77101.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hyphomonas neptunium
           ATCC 15444]
          Length = 323

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 228/321 (71%), Gaps = 2/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS +RG G  LP RVL+N +L  +V+T+D WI+ R GI +RH+A   E T+ +   AAR 
Sbjct: 4   RSFIRGTGSYLPERVLTNDELSEMVETTDAWIQERTGIKKRHVAADGELTSDIAVHAARR 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A M   +IDLI++AT+TPDQTFP+TA  +Q +LG   G AFD+QAVCSGF++A+ T
Sbjct: 64  ALEAAGMQASEIDLIVLATTTPDQTFPATATAVQAKLGTGPGAAFDVQAVCSGFLFALAT 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS ++ G+  + +VIG++TF+RI+DWSDR TCVLFGDG GA++LE VE  G+   D G+
Sbjct: 124 ADSLMKQGLFHKALVIGAETFTRIIDWSDRGTCVLFGDGGGAIVLECVEWDGAD--DAGV 181

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           ++ ++ +DG+  + LYVDGG S++ T+G +RMEG  VFK+AV      IE V   T LT 
Sbjct: 182 ITHHVRTDGTKSNLLYVDGGVSSTGTIGHVRMEGNKVFKHAVTNISAAIEAVLTETGLTS 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDWFVPHQAN RI++ +  KM IP +KV++TV  H NTSAASIPLAL   V+ GR K 
Sbjct: 242 ADIDWFVPHQANKRILDGVAKKMSIPEEKVVITVSEHANTSAASIPLALDHVVRSGRAKP 301

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L EAMGGGF+ G  L R
Sbjct: 302 GDLILSEAMGGGFSWGASLFR 322


>gi|260575263|ref|ZP_05843263.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter sp. SW2]
 gi|259022523|gb|EEW25819.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacter sp. SW2]
          Length = 323

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 235/323 (72%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+SN++L   VDTSD WI  R GI RR IA   +TT+ LG  AA 
Sbjct: 3   IRAVVRGVGHYLPERVVSNAELAQTVDTSDEWIVSRSGIERRCIAAAGQTTSDLGARAAE 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A    +D+D II+ATST D TFPS A  +Q R+GM RGFAFD+QAVC+GF++A+ 
Sbjct: 63  AALADAGWQANDLDAIILATSTADLTFPSAATMVQARIGMTRGFAFDVQAVCAGFIFALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  +RVMVIG++TFSR++DW+DR TCVLFGDGAGAL+LE VE +G+S AD G
Sbjct: 123 NANALIISGQAKRVMVIGAETFSRLMDWTDRGTCVLFGDGAGALLLEAVESEGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG + D LYVDGG ST  T G +RM+G+ +F++AVEK  +      +   L 
Sbjct: 182 ILATDLNSDGRFKDLLYVDGGTSTGVT-GKLRMQGREIFRHAVEKLAQTAHTALEKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII++   +M++P ++V+VTV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 SADVDWIVPHQANLRIISATAQRMQVPMERVVVTVQDHGNTSAASIPLALSVGRDRGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++ EA+GGG T G V+LRW
Sbjct: 301 QGDLIVTEAIGGGLTWGAVVLRW 323


>gi|218530286|ref|YP_002421102.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           chloromethanicum CM4]
 gi|218522589|gb|ACK83174.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           chloromethanicum CM4]
          Length = 326

 Score =  351 bits (900), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 242/323 (74%), Gaps = 2/323 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           RS V G G  LP  V++N+DL E  ++TSD WI +R GI +RHIA  DETT+ LG  AA 
Sbjct: 5   RSVVVGCGAYLPETVVTNTDLAERGIETSDEWIVQRTGIRQRHIARADETTSVLGTRAAM 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DIDL+I ATSTPD TFPS+A  IQ  LG++ GFAFD+QAVC+GFVYAV 
Sbjct: 65  AALEDAGLSPADIDLVICATSTPDHTFPSSATQIQAALGIEGGFAFDLQAVCAGFVYAVA 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  +R +VIG++TFSR++DW DR+TCVLFGDGAGA++LE  E +G+S AD G
Sbjct: 125 TADRFLTTGGAKRALVIGAETFSRLLDWEDRTTCVLFGDGAGAIVLEAREGEGTS-ADRG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS+ L SDG +  KLYVDGGP ++ T G +RMEG+ VF++AV    ++IE  F ++  T
Sbjct: 184 VLSSCLRSDGRHRAKLYVDGGPGSTGTTGKLRMEGREVFRFAVGSVTDVIEDAFRASGTT 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++ WFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR++
Sbjct: 244 ADDLAWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAARRDGRIR 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGFT G  L+RW
Sbjct: 304 EGDLVMIEAIGGGFTWGAALIRW 326


>gi|86138659|ref|ZP_01057232.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           MED193]
 gi|85824719|gb|EAQ44921.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           MED193]
          Length = 323

 Score =  351 bits (900), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 224/322 (69%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G G  LP+RV+ N++ E+ ++TSD WI+ R GI RRH A + ETT+ +   AA  
Sbjct: 4   RAVVVGTGHYLPKRVVENAEFEASLETSDEWIRSRSGIERRHFAAEGETTSDMATEAALA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +   DID I++ATST D TFPS A  +Q +LGM  GFAFD+QAVC+GFVYA+T 
Sbjct: 64  ALKDAGLEAKDIDAIVLATSTADLTFPSAATMVQAKLGMTNGFAFDVQAVCAGFVYALTN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIGS+TFSRI+DW+DRSTCVLFGDGAGAL+LE   + G++  D GI
Sbjct: 124 ANALILSGQADRVLVIGSETFSRIMDWTDRSTCVLFGDGAGALVLEAQSLSGTN-EDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST L SDG Y D LYVDGG +T  T G +RM+G  VF++AVEK  +      +   L+ 
Sbjct: 183 LSTDLNSDGRYKDLLYVDGGVATQNT-GHLRMQGNQVFRHAVEKLAKTANTALERAELST 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII     KM +  D V+VTV  HGNTSAASIPLAL+V    G++K 
Sbjct: 242 ADVDWIVPHQANIRIIQGTAKKMGLSMDNVVVTVQDHGNTSAASIPLALSVGKARGQIKA 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G V+LRW
Sbjct: 302 GDLIVTEAIGGGLAWGAVVLRW 323


>gi|149186062|ref|ZP_01864376.1| probable 3-oxoacyl-acyl-carrier-protein synthase iii [Erythrobacter
           sp. SD-21]
 gi|148830093|gb|EDL48530.1| probable 3-oxoacyl-acyl-carrier-protein synthase iii [Erythrobacter
           sp. SD-21]
          Length = 321

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 171/323 (52%), Positives = 235/323 (72%), Gaps = 3/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR+ + G G +LP+  ++N+DLE+ VDTSD WI  R GI +R+IAG+ ETT++L   AA
Sbjct: 1   MIRAVITGSGSALPKDCVTNADLEARVDTSDEWIVERTGIRQRYIAGEGETTSTLATEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +   +I LII+AT+TPD TFP+TA  +Q  LG + G AFD+ AVCSGF+YA+
Sbjct: 61  RKALDDAGVDASEIGLIILATATPDHTFPATATQVQQALGCRGGVAFDVAAVCSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+S +R+G+ ++ +VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  +V        
Sbjct: 121 GTAESLLRTGMAKKALVIGAETFSRILDWEDRTTCVLFGDGAGAVVLEAQDVAEDG---P 177

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T L +DG + D LYVDGGPST+  VG +RM+G+ VF++AV    +++ +V     +
Sbjct: 178 GILATKLHADGEHKDLLYVDGGPSTTGEVGKLRMKGREVFRHAVVNLADVLGEVLADASV 237

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  +IDW VPHQAN RI+++   K+ +P +KV+VTVD H NTSAAS+PLA  VA K+GR+
Sbjct: 238 TAADIDWVVPHQANARILDATARKLGLPAEKVVVTVDQHANTSAASVPLAFDVARKDGRI 297

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K GD ++ EAMGGGFT G  L R
Sbjct: 298 KPGDLVMFEAMGGGFTWGASLAR 320


>gi|240138643|ref|YP_002963115.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Methylobacterium extorquens AM1]
 gi|240008612|gb|ACS39838.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Methylobacterium extorquens AM1]
          Length = 326

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 242/323 (74%), Gaps = 2/323 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           RS V G G  LP  V++N+DL E  ++TSD WI +R GI +RHIA  DETT+ LG  AA 
Sbjct: 5   RSVVVGCGAYLPETVVTNTDLAERGIETSDEWIVQRTGIRQRHIARADETTSVLGTRAAM 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DIDL+I ATSTPD TFPS+A  IQ  LG++ GFAFD+QAVC+GFVYAV 
Sbjct: 65  AALDDAGLSPADIDLVICATSTPDHTFPSSATQIQAALGIEGGFAFDLQAVCAGFVYAVA 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  +R +VIG++TFSR++DW DR+TCVLFGDGAGA++LE  E +G+S AD G
Sbjct: 125 TADRFLTTGGAKRALVIGAETFSRLLDWEDRTTCVLFGDGAGAIVLEAREGEGTS-ADRG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS+ L SDG +  KLYVDGGP ++ T G +RMEG+ VF++AV    ++IE  F ++  T
Sbjct: 184 VLSSCLRSDGRHRTKLYVDGGPGSTGTTGKLRMEGREVFRFAVGSVTDVIEDAFRASGTT 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++ WFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR++
Sbjct: 244 ADDLAWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAARRDGRIR 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGFT G  L+RW
Sbjct: 304 EGDLVMIEAIGGGFTWGAALIRW 326


>gi|163851478|ref|YP_001639521.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           extorquens PA1]
 gi|254561241|ref|YP_003068336.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Methylobacterium
           extorquens DM4]
 gi|163663083|gb|ABY30450.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           extorquens PA1]
 gi|254268519|emb|CAX24476.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Methylobacterium extorquens DM4]
          Length = 326

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 242/323 (74%), Gaps = 2/323 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           RS V G G  LP  V++N+DL E  ++TSD WI +R GI +RHIA  DETT+ LG  AA 
Sbjct: 5   RSVVVGCGAYLPETVVTNTDLAERGIETSDEWIVQRTGIRQRHIARADETTSVLGTRAAM 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DIDL+I ATSTPD TFPS+A  IQ  LG++ GFAFD+QAVC+GFVYAV 
Sbjct: 65  AALDDAGLSPADIDLVICATSTPDHTFPSSATQIQAALGIEGGFAFDLQAVCAGFVYAVA 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  +R +VIG++TFSR++DW DR+TCVLFGDGAGA++LE  E +G+S AD G
Sbjct: 125 TADRFLTTGGAKRALVIGAETFSRLLDWEDRTTCVLFGDGAGAIVLEAREGEGTS-ADRG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS+ L SDG +  KLYVDGGP ++ T G +RMEG+ VF++AV    ++IE  F ++  T
Sbjct: 184 VLSSCLRSDGRHRAKLYVDGGPGSTGTTGKLRMEGREVFRFAVGSVTDVIEDAFRASGTT 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++ WFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR++
Sbjct: 244 ADDLAWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAARRDGRIR 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGFT G  L+RW
Sbjct: 304 EGDLVMIEAIGGGFTWGAALIRW 326


>gi|83952158|ref|ZP_00960890.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius
           nubinhibens ISM]
 gi|83837164|gb|EAP76461.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseovarius
           nubinhibens ISM]
          Length = 324

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 231/323 (71%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G+G  LP R++ N+  E  +DTSD WI+ R GI RRH A + ETT+ L  AA++
Sbjct: 3   LRAVVEGVGHYLPDRIVENAWFEEFLDTSDEWIRTRSGIERRHFAAEHETTSDLALAASK 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL +A +  DDID ++VATSTPD TFPS A  +QNRLGM +GFAFD+QAVC+GF+YA+ 
Sbjct: 63  AALANAGLEPDDIDCVLVATSTPDLTFPSVATMVQNRLGMTQGFAFDVQAVCAGFIYALC 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  RRV+VIG++TFSRI+DW DRSTCVLFGDGAGALIL G E    +  D G
Sbjct: 123 NANALIVSGQARRVLVIGAETFSRIMDWEDRSTCVLFGDGAGALIL-GAEEGVGTKEDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG Y D LYVDGG ST+ T G +RM+G  +F+ AVEK     E   +   L 
Sbjct: 182 ILATDLNSDGRYKDMLYVDGGVSTTGTAGKLRMQGNQLFRQAVEKLASTAETSLEKAGLL 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN RII+    K+ +  D+V++TV  HGNTSAASIPLAL+V V EGR+K
Sbjct: 242 SSEVDWIVPHQANIRIISGTARKLGLSMDRVVLTVQDHGNTSAASIPLALSVGVAEGRIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +L EA+GGG   G+V+LRW
Sbjct: 302 RGDLVLSEAIGGGLAWGSVVLRW 324


>gi|149914951|ref|ZP_01903480.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           AzwK-3b]
 gi|149811139|gb|EDM70976.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           AzwK-3b]
          Length = 324

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 228/323 (70%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G+G  LP R++ NS+ E  +DTSD WI+ R GI RRH A + +TT+ L   AAR
Sbjct: 3   LRAVVEGVGHYLPDRIVPNSEFEKTLDTSDEWIRTRSGIERRHFAAEGQTTSDLAARAAR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL +A + VD ID IIVATSTPD TFPS A  +Q  LGM RGF FD+QAVC+GF+YA+T
Sbjct: 63  AALENAGLDVDAIDGIIVATSTPDLTFPSVATMVQRDLGMTRGFGFDVQAVCAGFIYALT 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I +G  + ++VIG++TFSRI+DW+DRSTCVLFGDGAGA++L   E  G+  AD G
Sbjct: 123 NANALILAGQAKCLLVIGAETFSRIIDWTDRSTCVLFGDGAGAVVLRAQEGDGTK-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS  L SDG Y D LYVDGG S++   G +RM+G  +F+ AVEK     E   +   LT
Sbjct: 182 ILSADLNSDGRYRDMLYVDGGVSSTGHAGKLRMQGNPLFRQAVEKLTSTAETALEKIGLT 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     KM +  ++VIVTV  HGNTSAASIPLAL+V V EGR+K
Sbjct: 242 GTDVDWIVPHQANIRIIQGTAKKMGLSMEQVIVTVQDHGNTSAASIPLALSVGVAEGRIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +L EA+GGG   G V+LRW
Sbjct: 302 RGDLVLSEAIGGGLAWGAVVLRW 324


>gi|220926816|ref|YP_002502118.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           nodulans ORS 2060]
 gi|219951423|gb|ACL61815.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium
           nodulans ORS 2060]
          Length = 325

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/323 (56%), Positives = 239/323 (73%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS VRG G  LPR V++N DL + VDTSD WI +R GI +RHIAG DETT+ LG  AA 
Sbjct: 4   LRSVVRGCGSYLPRTVVTNDDLAARVDTSDEWIVQRTGIRQRHIAGPDETTSVLGIKAAA 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    IDLII ATSTPD TFPSTA  IQ  LG+  G AFD+QAVC+GFVY V 
Sbjct: 64  AALAAANLDPASIDLIICATSTPDHTFPSTATQIQAGLGIHGGAAFDLQAVCAGFVYGVA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  RR +V+G++TFSR++DW DR+TCVLFGDGAGA++LE    +G S  D G
Sbjct: 124 TADKFLTTGAARRALVVGAETFSRLLDWEDRTTCVLFGDGAGAIVLEAQGGEGHS-GDRG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+++L SDG Y +KLYVDGGP ++ T G +RM GK VF++AV    ++I + F +T  T
Sbjct: 183 VLTSHLRSDGRYREKLYVDGGPGSTGTTGKLRMVGKEVFRFAVGSVTDVIAEAFAATGTT 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DWFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR++
Sbjct: 243 AEDLDWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAACRDGRIR 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGF  G+ L+RW
Sbjct: 303 RGDLVMIEAIGGGFAWGSALIRW 325


>gi|254437842|ref|ZP_05051336.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Octadecabacter
           antarcticus 307]
 gi|198253288|gb|EDY77602.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Octadecabacter
           antarcticus 307]
          Length = 323

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 228/323 (70%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ NS+ E+ +DT+D WIK R GI RRH A + +TT+ L   AA+
Sbjct: 3   IRAIVRGVGHYLPDRVVPNSEFEASLDTTDEWIKARSGIERRHFAAQGQTTSDLATRAAK 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DID II+ATST D TFPS A  +Q  +G   G+AFD+QAVC+GFV+A++
Sbjct: 63  AALSDAGLDGSDIDAIILATSTADLTFPSAATMVQRNIGNTTGYAFDIQAVCAGFVFALS 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  +RV+VIG++TFSRI+DW+DR TCVLFGDGAGAL+LE  +    +  D G
Sbjct: 123 NANALILSGQAKRVLVIGAETFSRIMDWTDRGTCVLFGDGAGALVLEATD-GADNPDDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL+T L SDG+Y D LYVDGG ST  T G +RM+GK VF++AVEK             L 
Sbjct: 182 ILATDLNSDGTYCDLLYVDGGVSTQNT-GMLRMQGKEVFRHAVEKLASTAITALQKAGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++DW VPHQAN RII S   K+ +P D+V+VTV  HGNTSAASIPLAL+V V+ G+VK
Sbjct: 241 HDDVDWVVPHQANIRIIQSTAKKLGVPMDRVVVTVQDHGNTSAASIPLALSVGVQRGQVK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD ++ EA+GGG   G V+LRW
Sbjct: 301 PGDLVVTEAIGGGLAWGAVVLRW 323


>gi|56697342|ref|YP_167710.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ruegeria pomeroyi
           DSS-3]
 gi|81558445|sp|Q5LQJ5|FABH_SILPO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|56679079|gb|AAV95745.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ruegeria pomeroyi
           DSS-3]
          Length = 323

 Score =  348 bits (893), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 179/322 (55%), Positives = 228/322 (70%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V+G+G  LP RV+ N+  E  +DT+D WI+ R GI RRH A + ETT+ L   AA  
Sbjct: 4   RAVVKGVGHYLPERVVPNAAFEKTLDTTDEWIRSRSGIERRHFAAEGETTSDLATRAAEA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +S + ID I++ATST D TFPS A  +Q RLGM  G+AFD+QAVC+GFVYA++ 
Sbjct: 64  ALADAGISAEQIDAIVLATSTADLTFPSAATMVQARLGMTNGYAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG  +RV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  E +G+   D GI
Sbjct: 124 ANALIVSGQAKRVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVLEYEEGEGTPQ-DRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LS  L SDG Y D LYVDGG ST +T G +RM+G  VF++AVEK  +  E   D   L+ 
Sbjct: 183 LSVDLNSDGRYKDLLYVDGGVST-QTTGHLRMQGNQVFRHAVEKLAQTAETALDKAGLSS 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII     KM +P DKV+VTV  HGNTSAASIPLAL+V    G++K 
Sbjct: 242 ADVDWIVPHQANIRIIQGTAKKMGLPMDKVVVTVQDHGNTSAASIPLALSVGKARGQIKT 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G V+LRW
Sbjct: 302 GDLVVTEAIGGGLAWGAVVLRW 323


>gi|329114626|ref|ZP_08243385.1| 3-oxoacyl- synthase 3 [Acetobacter pomorum DM001]
 gi|326696106|gb|EGE47788.1| 3-oxoacyl- synthase 3 [Acetobacter pomorum DM001]
          Length = 326

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 234/321 (72%), Gaps = 4/321 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G  LP +V+SN++L   ++TSD WIK R GI+RRH+ G ++T AS+G  AAR 
Sbjct: 9   RSLLVGFGGFLPDQVVSNAELAERLETSDEWIKTRTGITRRHLVGPNDTAASMGAEAARR 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A ++ +DID + VAT+TPDQ FP+TAV +Q  LGMK+GF FD+ A CSGF++A++T
Sbjct: 69  ALDYAGLTAEDIDAVFVATATPDQAFPATAVRVQAALGMKQGFGFDITAACSGFIFALST 128

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD++IRSG +R  +VIGS+ +SRI+DW DR+TCVLFGDGAGA++L   +  G    + GI
Sbjct: 129 ADAFIRSGQIRNALVIGSEVYSRIMDWEDRTTCVLFGDGAGAVVLSASDEPG----ERGI 184

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST+L SDG+  D LYVDG        G ++M G+ VF++AV K    +++  ++  L+ 
Sbjct: 185 LSTHLHSDGTAGDLLYVDGAVGQPDKSGHLKMSGRDVFRHAVGKLSSSVDEALEAEGLSY 244

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW VPHQAN RII  +  K+ +P ++V++TVD H NTSAAS+PLAL  AV++GR++K
Sbjct: 245 ADVDWLVPHQANIRIIEGVAKKLNLPAERVVITVDRHANTSAASVPLALDEAVRDGRIQK 304

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L+EA+GGG T G+ L+R
Sbjct: 305 GDLVLMEALGGGLTWGSALVR 325


>gi|170744276|ref|YP_001772931.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium sp.
           4-46]
 gi|168198550|gb|ACA20497.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacterium sp.
           4-46]
          Length = 325

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 184/323 (56%), Positives = 239/323 (73%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS VRG G  LPR V++N DL + VDTSD WI +R GI +RHIAG DETT+ LG  AAR
Sbjct: 4   LRSVVRGCGSYLPRTVVTNDDLAARVDTSDEWIVQRTGIRQRHIAGPDETTSVLGIRAAR 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A++    IDLII ATSTPD TFPSTA  IQ+ LG+  G AFD+QAVC+GFVY V 
Sbjct: 64  AALAEADIDPASIDLIICATSTPDHTFPSTATQIQDGLGIHGGAAFDLQAVCAGFVYGVA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ +G  RR +VIG++TFSR++DW DR+TCVLFGDGAGA++LE    +G S  D G
Sbjct: 124 TADKFLTTGAARRALVIGAETFSRLLDWEDRTTCVLFGDGAGAIVLEAQPGEGHS-GDRG 182

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L+++L SDG Y +KLYVDGGP ++ T G +RM GK VF++AV    ++I   F +T   
Sbjct: 183 VLTSHLRSDGRYREKLYVDGGPGSTGTTGKLRMVGKEVFRFAVGSVTDVINDAFAATGTR 242

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++DWFVPHQAN RII +  DK+ I  +KV++TVD HGNTSAASIPLAL  A ++GR+ 
Sbjct: 243 AEDLDWFVPHQANRRIIEASADKLGIAREKVVLTVDRHGNTSAASIPLALDAACRDGRIA 302

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +++EA+GGGF  G+ L+RW
Sbjct: 303 RGDLVMIEAIGGGFAWGSALIRW 325


>gi|163741402|ref|ZP_02148793.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Phaeobacter
           gallaeciensis 2.10]
 gi|161385136|gb|EDQ09514.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Phaeobacter
           gallaeciensis 2.10]
          Length = 306

 Score =  345 bits (885), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 168/308 (54%), Positives = 223/308 (72%), Gaps = 2/308 (0%)

Query: 17  VLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDL 76
           ++ N++ E+ +DT+D WI+ R GI RRH A + ETT+ +   AA++AL  A M+ +DID 
Sbjct: 1   MVENAEFEATLDTTDEWIRSRSGIERRHFAAEGETTSMMATKAAQNALADAGMTAEDIDA 60

Query: 77  IIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVM 136
           I+VATST D TFPS A  +Q +LGM RGFAFD+QAVC+GFVYA++ A++ + SG   +V+
Sbjct: 61  IVVATSTADLTFPSAATMVQAQLGMTRGFAFDVQAVCAGFVYALSNANALVASGQASKVL 120

Query: 137 VIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDK 196
           VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  +  G+S  D GIL+T L SDG Y D 
Sbjct: 121 VIGAETFSRIMDWTDRSTCVLFGDGAGALVLEAQDSAGTS-DDRGILATDLNSDGRYKDL 179

Query: 197 LYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWR 256
           LYVDGG ST  T G +RM+G  VF++AVEK         +   L  +++DW VPHQAN R
Sbjct: 180 LYVDGGVSTQNT-GHLRMQGNQVFRHAVEKLASTAHTALERAGLGADDVDWIVPHQANIR 238

Query: 257 IINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFT 316
           II     KM +P +KV+VTV  HGNTSAASIPLAL+V    G++K+GD ++ EA+GGG  
Sbjct: 239 IIQGTAKKMGLPMEKVVVTVQDHGNTSAASIPLALSVGKARGQIKQGDLVVTEAIGGGLA 298

Query: 317 SGTVLLRW 324
            G+V+LRW
Sbjct: 299 WGSVVLRW 306


>gi|326386989|ref|ZP_08208599.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208170|gb|EGD58977.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 328

 Score =  345 bits (884), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 237/321 (73%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ + G G +LP R++SN+++  +VDT+D WI  R GI  R+IAG+ ETT+SL   AAR 
Sbjct: 7   RAVIIGSGSALPERIVSNAEMAEMVDTTDEWIVERTGIRARYIAGEGETTSSLATLAARR 66

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +   D+DLII+AT+TPDQTFP++A  +Q+ LG   G AFD+ AVCSGF+YA+TT
Sbjct: 67  ALDAAGVDAKDVDLIILATATPDQTFPASATIVQHNLGCNGGIAFDIAAVCSGFLYALTT 126

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+ +R+G  R  +VIG++TFSRI+DW DR+TCVLFGDGAGA++L+  +V  +     GI
Sbjct: 127 ADAMLRAGNARCALVIGAETFSRILDWEDRTTCVLFGDGAGAMLLQARDVDPTDPQAPGI 186

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L++ L +DG+Y D LYVDGGPST++TVG +RM+G+ VF++AV     ++E+V  ST    
Sbjct: 187 LASRLHADGAYNDMLYVDGGPSTTQTVGKLRMKGREVFRHAVVNLASVLEEVLTSTGRQA 246

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDW VPHQAN+RI+++   K+ +P +KV+VTVD H NTSAAS+PLA   AV++GR++ 
Sbjct: 247 SDIDWVVPHQANFRILDATARKLGLPAEKVVVTVDHHANTSAASVPLAYDEAVRDGRIRP 306

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           G  ++ EAMGGGFT G  L R
Sbjct: 307 GQLVMFEAMGGGFTWGAALAR 327


>gi|84516336|ref|ZP_01003696.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Loktanella
           vestfoldensis SKA53]
 gi|84510032|gb|EAQ06489.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Loktanella
           vestfoldensis SKA53]
          Length = 323

 Score =  343 bits (879), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 234/322 (72%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ VRGIG  LP R++ NS+ E  +DTSD WIK R GI RRH A + +TT+ L   AA+ 
Sbjct: 4   RAVVRGIGHYLPDRIVPNSEFEKTLDTSDEWIKTRSGIERRHFAAEGQTTSDLAIHAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A+++ +DID I++ATST D TFPSTA  +Q+ +G   G+AFD+QAVC+GFVYA++T
Sbjct: 64  ALAMAQIAPNDIDAIVLATSTSDLTFPSTATMVQHAIGNTTGYAFDIQAVCAGFVYAMST 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG    VMVIG++TFS+I+DW+DR+TCVLFGDGAGALIL   +  GS+ AD GI
Sbjct: 124 ANALITSGQANTVMVIGAETFSKILDWTDRATCVLFGDGAGALILSAEDGDGST-ADRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LS  L SDG Y D LYVDGG ST +T G +RMEG+ +F++AVEK  +  +       LT 
Sbjct: 183 LSVDLNSDGRYRDMLYVDGGVST-QTTGVVRMEGRELFRHAVEKLAQTADTALHKVGLTA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           +++ W VPHQAN RII +   K+ +  D+V+VTV  HGNTSAASIPLAL+V V  G++K+
Sbjct: 242 DDVAWVVPHQANIRIIQATAKKLGVGMDRVVVTVQDHGNTSAASIPLALSVGVANGQIKR 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G+V+LRW
Sbjct: 302 GDLVVTEAIGGGLAWGSVVLRW 323


>gi|254492066|ref|ZP_05105242.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylophaga
           thiooxidans DMS010]
 gi|224462730|gb|EEF79003.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylophaga
           thiooxydans DMS010]
          Length = 319

 Score =  342 bits (876), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 232/326 (71%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI S + G G  LP +VL+N DLES+V+T+D WI  R GI +RHIA  DETT  L   AA
Sbjct: 1   MIYSRIAGTGSYLPEKVLTNHDLESMVETTDQWITDRTGIKKRHIAADDETTTDLAYQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A +S +DIDLIIVAT+TP + FPSTA  +Q++LG+    AFD+QAVC+GFVYA+
Sbjct: 61  IKAIEAAGISNNDIDLIIVATTTPTRIFPSTASLLQHKLGIGGCPAFDVQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T AD +I++G V  V+VIG++TFSRI+DW+DR+TCVLFGDGAGA++L+  E         
Sbjct: 121 TVADKFIKAGGVNNVLVIGAETFSRIIDWTDRNTCVLFGDGAGAVVLQASE-------QP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRT--VGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GILST++ SDGSY + L+V  GP ++ T     + M+G  VFK AV+    ++++  D+ 
Sbjct: 174 GILSTHIHSDGSYNELLHVPTGPGSAVTDDAAYVDMQGNEVFKVAVKTLSSIVDETLDAN 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +   ++DW +PHQAN RII +   K+ +  D V+VTVD HGNTSAASIPLAL VAV++G
Sbjct: 234 QMAKTDVDWLIPHQANIRIIAATARKLNMSMDHVVVTVDEHGNTSAASIPLALDVAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+G+ LL EA GGGFT G+ L+++
Sbjct: 294 RIKRGETLLFEAFGGGFTWGSALIQY 319


>gi|254465642|ref|ZP_05079053.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium Y4I]
 gi|206686550|gb|EDZ47032.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium Y4I]
          Length = 307

 Score =  341 bits (875), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 168/308 (54%), Positives = 224/308 (72%), Gaps = 1/308 (0%)

Query: 17  VLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDL 76
           ++ N++ E+ +DT+D WI+ R GI RRH A + ETT+ +   AA  AL  A +S DD+D 
Sbjct: 1   MVENAEFEASLDTTDEWIRTRSGIERRHFAAEGETTSDMAAKAAERALADAGLSADDVDA 60

Query: 77  IIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVM 136
           I+VATST D TFPS A  +Q++LGM +GFAFD+QAVC+GFVYA++ A++ I SG   RV+
Sbjct: 61  IVVATSTADLTFPSAATMVQSKLGMTKGFAFDVQAVCAGFVYALSNANALIASGQASRVL 120

Query: 137 VIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDK 196
           VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LEG E+ G++  D GIL+T L SDG Y D 
Sbjct: 121 VIGAETFSRIMDWTDRSTCVLFGDGAGALLLEGQELAGTN-KDRGILATDLNSDGRYKDL 179

Query: 197 LYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWR 256
           LYVDGG S++++ G +RM+G  VF++AVEK         D   L+  ++DW VPHQAN R
Sbjct: 180 LYVDGGVSSTQSTGHLRMQGNQVFRHAVEKLASTANTALDRAGLSAADVDWIVPHQANIR 239

Query: 257 IINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFT 316
           II     KM +  D V+VTV  HGNTSAASIPLAL+V  + G++K+GD ++ EA+GGG  
Sbjct: 240 IIQGTAKKMGLSMDNVVVTVQDHGNTSAASIPLALSVGKERGQIKEGDLIVTEAIGGGLA 299

Query: 317 SGTVLLRW 324
            G V+LRW
Sbjct: 300 WGAVVLRW 307


>gi|330994018|ref|ZP_08317948.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Gluconacetobacter sp.
           SXCC-1]
 gi|329758964|gb|EGG75478.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Gluconacetobacter sp.
           SXCC-1]
          Length = 323

 Score =  341 bits (875), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 166/321 (51%), Positives = 224/321 (69%), Gaps = 3/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ + G G  LP R+++N +L + +DTSD WI+ R GI +RH AG+ +T  S+   AAR 
Sbjct: 5   RALLSGFGGYLPERIVTNDELATGLDTSDEWIRARTGIRQRHRAGEGDTAVSMAAHAARQ 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A  S DD+D +IVATSTPD+ FP+TAV +Q  LGM RGF FD+ A CSGF++A++ 
Sbjct: 65  ALDYAGASPDDVDAVIVATSTPDEAFPATAVRVQAALGMTRGFGFDLAAACSGFIFALSM 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS IRSG  R  +VIGS+ +SRI+DWSDR TCVLFGDGAGA+ L G    G    + GI
Sbjct: 125 ADSLIRSGQARSALVIGSEVYSRILDWSDRGTCVLFGDGAGAVFLTGA---GPEDGEAGI 181

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST+L SDG Y D LYVDG          +RM+G+ VF++AV K    +++   +  L  
Sbjct: 182 LSTHLHSDGQYGDLLYVDGATGQHDRPAHLRMQGRDVFRHAVAKLSSSVDEALAANGLGH 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +++W VPHQAN RII+ +  K+ +P ++V+VTVD H NTSAASIPLAL  AV++GR++K
Sbjct: 242 ADVNWLVPHQANLRIIDGVARKLDLPPERVVVTVDRHANTSAASIPLALNEAVRDGRIRK 301

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L+EA+GGG T G+ L R
Sbjct: 302 GDLVLMEALGGGLTWGSALAR 322


>gi|182680279|ref|YP_001834425.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Beijerinckia indica
           subsp. indica ATCC 9039]
 gi|182636162|gb|ACB96936.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Beijerinckia indica
           subsp. indica ATCC 9039]
          Length = 326

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 245/324 (75%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
            +RS V G+G  LP+R++SN D+  +++TSD WI +R GI +RH+AG+ E T+ LG  AA
Sbjct: 4   QLRSVVVGLGAYLPKRIVSNDDIAKMLETSDDWIVQRTGIRQRHVAGEGEQTSVLGLRAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +S  DIDLIIVATSTPD TFP+ A  IQ  LGM  G AFD+QAVCSGFVYAV
Sbjct: 64  QAALADAGLSGADIDLIIVATSTPDYTFPAVATQIQAALGMTHGAAFDVQAVCSGFVYAV 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD ++ SG  +R +VIG++TFS+++DWSDRSTCVLFGDGAGA++LE     G  ++D 
Sbjct: 124 TTADKFLISGSHKRALVIGAETFSKLLDWSDRSTCVLFGDGAGAIVLEARPGTG-RISDR 182

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L++ L SDG ++ KLYVDGGPST+ T G +RM G+ VF++AV    +++   F++T +
Sbjct: 183 GVLTSQLRSDGRHLTKLYVDGGPSTTGTTGHLRMAGREVFRHAVGMVSDVVNAAFEATGI 242

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  ++DWFVPHQAN RII +  +K+ I   KV+VTVD+HGNTSAASIPLALA A  +GR+
Sbjct: 243 TGADLDWFVPHQANRRIIEASAEKLGIAPHKVVVTVDLHGNTSAASIPLALAKARDDGRI 302

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +++EAMGGGFT  + L+RW
Sbjct: 303 KQGDLVMIEAMGGGFTWASALIRW 326


>gi|254419241|ref|ZP_05032965.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brevundimonas sp.
           BAL3]
 gi|196185418|gb|EDX80394.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brevundimonas sp.
           BAL3]
          Length = 325

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 170/321 (52%), Positives = 227/321 (70%), Gaps = 1/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS V G+G  LP ++++N+DL   VDTSD WI+ R GI +RH A  D+ T+ L   AAR 
Sbjct: 5   RSAVTGVGSYLPEQIVTNADLAKFVDTSDEWIQERTGIKQRHKARDDQPTSDLAVEAARK 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  +  D+DLIIVAT+TPD TFP+ A  +Q++LG   G AFD+QAVCSGFVYA++ 
Sbjct: 65  ALADAGKTAADVDLIIVATTTPDMTFPAVASIVQHKLGAGVGVAFDVQAVCSGFVYALSV 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD ++  G+ +  +VIG++  +R++DW+DR+TCVLFGDGAGA++LE  E +G+S AD G+
Sbjct: 125 ADGFVARGLSKCALVIGAEEMTRLMDWTDRTTCVLFGDGAGAVVLEPREGQGTS-ADQGM 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L   L +DGS  D LYVDGGP+T+ TVG +RM G  VF++AV    E I     +  + I
Sbjct: 184 LGFALRADGSKTDLLYVDGGPATTGTVGHLRMAGNQVFRHAVVNIAEGITAACAAADIEI 243

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DWFVPHQAN RII  + D++ +   KVI TV +H NTSAASIPLAL  A+++GR+KK
Sbjct: 244 SDVDWFVPHQANQRIIKGVGDRLGLDETKVISTVALHANTSAASIPLALDAAIQDGRIKK 303

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +LLEAMGGG T G   LR
Sbjct: 304 GDMVLLEAMGGGLTWGACALR 324


>gi|255262421|ref|ZP_05341763.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Thalassiobium sp.
           R2A62]
 gi|255104756|gb|EET47430.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Thalassiobium sp.
           R2A62]
          Length = 323

 Score =  339 bits (870), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 170/323 (52%), Positives = 231/323 (71%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V+G+G  LP R++ N++ E+ +DT+D WI+ R GI  RH A + ETT+ L   AA 
Sbjct: 3   VRAVVKGVGHYLPERIVPNAEFETFLDTTDDWIQSRSGIKNRHFAAEGETTSDLATHAAN 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DID I++ATST D TFPS+A  +Q+ +G   G+AFD+QAVC+GFV+A++
Sbjct: 63  AALADAGLQGSDIDAIVLATSTADLTFPSSATKVQHAIGNTNGYAFDIQAVCAGFVFALS 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG   RV+VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  E    + AD G
Sbjct: 123 NANALIASGQAERVLVIGAETFSRIMDWTDRSTCVLFGDGAGALVLE-AETGAGTSADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LS  L SDGS+ + LYVDGG ST  T G +RMEG+ VF++AVEK  +      +   L 
Sbjct: 182 VLSVDLNSDGSHRNLLYVDGGVSTQST-GHLRMEGQEVFRHAVEKLAQTAHTALNKIGLG 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII S   K+ +P D+V+VTV+ HGNTSAASIPLAL+V  + G++K
Sbjct: 241 AGDVDWVVPHQANIRIIKSTARKLGVPMDRVVVTVENHGNTSAASIPLALSVGKERGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD L+ EA+GGG   G+V+LRW
Sbjct: 301 QGDLLVTEAIGGGLAWGSVVLRW 323


>gi|58038601|ref|YP_190565.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Gluconobacter
           oxydans 621H]
 gi|58001015|gb|AAW59909.1| 3-Oxoacyl-[acyl-carrier-protein] synthase III [Gluconobacter
           oxydans 621H]
          Length = 324

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/324 (51%), Positives = 227/324 (70%), Gaps = 7/324 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEAA 59
           IR  + G+G  LPR V++N DL     ++TSD WI+ R GI +RHIA  DETTAS+   A
Sbjct: 5   IRVRLTGVGGYLPRDVVTNDDLARKFGIETSDEWIRTRTGIGQRHIASGDETTASMAAEA 64

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYA 119
           AR AL +A +    +D ++VAT+TPDQ FP+ AV +Q  LGM  GF FD+ A CSGFVYA
Sbjct: 65  ARQALDYAGVDASQVDAVLVATATPDQVFPAVAVQVQACLGMTAGFGFDISAACSGFVYA 124

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           + TA + ++SG   +V+VIGS+ FSR++DW+DRSTCVLFGDGAGA++LE    +G     
Sbjct: 125 LATATALMQSGQANKVLVIGSEVFSRLLDWTDRSTCVLFGDGAGAVLLETGAGEGE---- 180

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            G+LST+L SDG   D LYVDG      T   +RM+G+ VF++AV K  + +++  ++  
Sbjct: 181 -GVLSTHLHSDGRTGDILYVDGAAGCPSTSQHLRMQGREVFRHAVVKLSQAVDEALEANG 239

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT ++I W VPHQAN RII  +  K+ +P D+V+VTVD H NTSAASIPLAL  AV++GR
Sbjct: 240 LTGQDIQWMVPHQANLRIIEGMAKKLALPADRVVVTVDRHANTSAASIPLALNEAVRDGR 299

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           V+KGD +L+EA+GGG T G+ L+R
Sbjct: 300 VRKGDLVLMEALGGGLTWGSALIR 323


>gi|332187011|ref|ZP_08388752.1| 3-oxoacyl-[acyl-carrier-] synthase 3 family protein [Sphingomonas
           sp. S17]
 gi|332013021|gb|EGI55085.1| 3-oxoacyl-[acyl-carrier-] synthase 3 family protein [Sphingomonas
           sp. S17]
          Length = 322

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 176/324 (54%), Positives = 234/324 (72%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRS V G G +LP R +SN +L   VDTSD WI  R GI  RHIAG +ETTA+L   AA
Sbjct: 1   MIRSIVTGTGSALPTRRVSNDELAQEVDTSDEWIVERTGIRFRHIAGPEETTATLAADAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+  A +S  DIDLI++AT+TPDQTFP+TA  +Q  LG+    AFD+ AVCSGF+YAV
Sbjct: 61  KAAIAAAGLSAQDIDLIVLATATPDQTFPATATKVQAMLGINDCVAFDVAAVCSGFLYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD+ +RSGV RR +VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  E         
Sbjct: 121 QVADAMLRSGVQRRALVIGAETFSRILDWEDRTTCVLFGDGAGAMVLEARE--SDDEGGR 178

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL+T L +DG +   LYVDGGPS++ TVG +RM+G+ VF++AV    +++E+      L
Sbjct: 179 GILATKLHADGRHNGLLYVDGGPSSTGTVGKLRMKGREVFRHAVVNLAQVMEEALGLAGL 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +  ++DW VPHQAN RI+++   K+ +P  KVIVTVD H NTSAAS+PLAL  AV++GR+
Sbjct: 239 SAADVDWVVPHQANARILDATARKLDLPAGKVIVTVDQHANTSAASVPLALDTAVRDGRI 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++ D ++LEAMGGGFT G  ++R+
Sbjct: 299 RQNDLIVLEAMGGGFTWGAAVIRF 322


>gi|88658133|ref|YP_507266.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ehrlichia
           chaffeensis str. Arkansas]
 gi|123493507|sp|Q2GH17|FABH_EHRCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|88599590|gb|ABD45059.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 319

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 229/323 (70%), Gaps = 5/323 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RST+ GIG  LP+++++N +L   V+TSD WI +R GI +RHIA  +E T+ +   AA
Sbjct: 1   MKRSTILGIGSYLPKKIVTNDELALTVETSDEWIVKRTGIKQRHIAENNEMTSDMAANAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +  DDI LIIVAT+TPD+TFPS A  +Q++L  K  FAFD+QAVCSGFVYA+
Sbjct: 61  RLALTDACVHKDDIGLIIVATTTPDRTFPSCATIVQDKLECKNAFAFDIQAVCSGFVYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD++I+SG V   +VIG++  SRI+DW DRSTCVLFGDGAGA++L       +S  D+
Sbjct: 121 SIADNFIKSGQVNTALVIGAEIMSRILDWQDRSTCVLFGDGAGAVVL-----GNNSEKDS 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ST L SDG++ D LY  GG + +   G I M G  VF++A+EK    I ++ D   L
Sbjct: 176 GIISTILHSDGAFCDLLYTTGGTAYNGHAGTICMNGTIVFEHAIEKLSASILEILDQNDL 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            I ++DWFV HQAN RII  +  ++KIP++K++V+V+ HGNTSAASIPLAL+ A   G++
Sbjct: 236 EINDVDWFVLHQANIRIIELVARRLKIPYEKMVVSVNWHGNTSAASIPLALSYAKSSGKL 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KK D  +L A+GGGFT GT L+R
Sbjct: 296 KKHDIAILAAIGGGFTWGTCLVR 318


>gi|163793228|ref|ZP_02187204.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [alpha
           proteobacterium BAL199]
 gi|159181874|gb|EDP66386.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [alpha
           proteobacterium BAL199]
          Length = 347

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 154/311 (49%), Positives = 224/311 (72%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ + G G  LP R+++N +L   V+TSD WI++R GI +RHIA   E T+ L   AA
Sbjct: 2   MRRTLLIGSGSYLPERIVTNEELAVRVNTSDEWIRQRTGIGQRHIAADGELTSDLATKAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL HA ++ +D+D+I++AT+TPD TFP+TA  +Q  +G  + FAFD+QAVC+GFVYA+
Sbjct: 62  ERALLHAGLTAEDVDVIVMATTTPDSTFPATATKVQANIGATQAFAFDVQAVCAGFVYAL 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD++++ G  R  +VIG++TFSRI+DW DRSTCVLFGDGAGA++L   ++ G      
Sbjct: 122 AVADNFLKLGQARTALVIGAETFSRILDWEDRSTCVLFGDGAGAVVLRAADLSGPDAQSW 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+LST+L +DG+  D LYVDGGPS++ TVG +RM GK V+++AV K   +I++   +  L
Sbjct: 182 GVLSTHLHTDGTARDALYVDGGPSSTGTVGHVRMNGKEVYRHAVSKLAAVIDETLAANGL 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +   +DW VPHQAN RII S+ +++++P  KVI +++ H NTSAAS+PLA   AV++GR+
Sbjct: 242 SASQVDWLVPHQANRRIIESMANRLEMPMSKVICSIERHANTSAASVPLAFDEAVRDGRI 301

Query: 301 KKGDCLLLEAM 311
           K GD +L+EA+
Sbjct: 302 KPGDVVLVEAI 312


>gi|296116567|ref|ZP_06835177.1| 3-oxoacyl-(acyl carrier protein) synthase III [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976779|gb|EFG83547.1| 3-oxoacyl-(acyl carrier protein) synthase III [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 322

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 163/321 (50%), Positives = 226/321 (70%), Gaps = 4/321 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS ++G G  LP R+++N +L S ++TSD WI+ R GI++RH AG ++T  S+   A R 
Sbjct: 5   RSLLKGFGGYLPDRIVTNDELASRLETSDEWIRARTGIAQRHRAGPEDTAVSMAAHAGRQ 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A  S DD+D IIVATSTPDQ FPSTAV +Q  LG+  GF FD+ A CSGF++A++T
Sbjct: 65  ALEYANASADDVDAIIVATSTPDQAFPSTAVRVQAELGITGGFGFDIAAACSGFIFALST 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD+ IRSG  R  +VIGS+ +SRI+D  DRST VLFGDGAGA+ L+  E  G+     GI
Sbjct: 125 ADALIRSGQARSALVIGSEVYSRILDPDDRSTFVLFGDGAGAVFLQATEESGTQ----GI 180

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           +ST++ SDG Y D LYVDG    S     ++M+G+ VF++AV K    +++V  +  L  
Sbjct: 181 VSTHMHSDGRYGDLLYVDGAIGQSEKSAHLKMQGRDVFRHAVAKLSSSVDEVLAANGLKY 240

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           E++ W VPHQAN RII+ +  K+++P ++V++TVD H NTSAASIPLAL  AV++GR++ 
Sbjct: 241 EDVAWLVPHQANLRIIDGVARKLQLPPERVVITVDRHANTSAASIPLALNEAVRDGRIRS 300

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD +L+EA+GGG T G+ L R
Sbjct: 301 GDLVLMEALGGGLTWGSALAR 321


>gi|126736414|ref|ZP_01752156.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           CCS2]
 gi|126714235|gb|EBA11104.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           CCS2]
          Length = 323

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/322 (53%), Positives = 229/322 (71%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V+G+G  LP RV+ N++ E  +DTSD WIK R GI RRH A + +TT+ L   AA+ 
Sbjct: 4   RAVVKGVGHYLPERVVPNAEFEKTLDTSDEWIKTRSGIERRHFAAEGQTTSDLAIKAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A M  DDID I++ATST D TFPS A  +Q  +G   G+AFD+QAVC+GFVYA++ 
Sbjct: 64  ALANAHMDGDDIDAIVLATSTADLTFPSAATMVQTAIGNTSGYAFDVQAVCAGFVYALSN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIG++TFSRI+DW+DR+TCVLFGDGAGALILE  E  G + +D GI
Sbjct: 124 ANALIASGQADRVLVIGAETFSRIMDWTDRATCVLFGDGAGALILEAEEGTGET-SDRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LS  L SDG Y D LYVDGG ST  T G +RM+G  +F++AVEK  +  +       L+ 
Sbjct: 183 LSVDLNSDGRYKDLLYVDGGVSTQNT-GMLRMKGSELFRHAVEKLAQTADSALQKAGLSA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++++W VPHQAN RII S   K+ +  D+V+VTV  HGNTSAASIPLAL+V V  G++K+
Sbjct: 242 DDVNWVVPHQANIRIIQSTAKKLGVGMDRVVVTVQDHGNTSAASIPLALSVGVANGQIKQ 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD ++ EA+GGG   G V++RW
Sbjct: 302 GDLVVTEAIGGGLAWGAVVIRW 323


>gi|307293479|ref|ZP_07573323.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sphingobium
           chlorophenolicum L-1]
 gi|306879630|gb|EFN10847.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sphingobium
           chlorophenolicum L-1]
          Length = 322

 Score =  336 bits (862), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 232/321 (72%), Gaps = 3/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G +LP R +SN++L   VDTSD WI  R GI  R+IAG  ETT++L   AAR 
Sbjct: 4   RSVLLGTGSALPARAVSNAELAETVDTSDEWIVERTGIRTRYIAGAGETTSTLATDAARA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +   DIDLII+AT+TPDQTFP++A  +Q  LG+    AFD+ AVCSGF+YA+T 
Sbjct: 64  ALEAAGIGAQDIDLIILATATPDQTFPASATIVQAALGINDCVAFDVAAVCSGFLYAITV 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS I SG  R  +VIGS+TFSRI+DW DR+TCVLFGDGAGA++L   E   S+    GI
Sbjct: 124 ADSMICSGAARNAIVIGSETFSRILDWEDRTTCVLFGDGAGAVVLGAEE---STDGKRGI 180

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L++ L +DG +   LYVDGGPST++TVG +RM+G+ VF++AV     ++ +V  +  +T 
Sbjct: 181 LASKLHADGRHNQLLYVDGGPSTTQTVGKLRMKGQEVFRHAVTNLASVLTEVMAAADMTP 240

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDW VPHQAN RI+++   K+K+  +KV++TVD H NTSAAS+PLAL +AV++GR+K 
Sbjct: 241 ADIDWLVPHQANARILDATARKLKLAPEKVVMTVDRHANTSAASVPLALDLAVRDGRIKS 300

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD L+LEAMGGGFT G  +LR
Sbjct: 301 GDLLVLEAMGGGFTWGACVLR 321


>gi|73667190|ref|YP_303206.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ehrlichia canis str.
           Jake]
 gi|123614842|sp|Q3YRP7|FABH_EHRCJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|72394331|gb|AAZ68608.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ehrlichia canis str.
           Jake]
          Length = 319

 Score =  335 bits (859), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 230/323 (71%), Gaps = 5/323 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS + GIG  LP++V++N +L   ++TSD WI +R GI +RHIA  +E T+ +  +AA
Sbjct: 1   MKRSLILGIGSYLPKKVVTNDELTLTIETSDEWIVKRTGIKQRHIAEDNEMTSDMATSAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +  ++IDLIIVAT+TPD+TFPS A  +Q++LG K  FAFD+QAVCSGFVYA+
Sbjct: 61  KLALDNAGIDKNEIDLIIVATTTPDRTFPSCATIVQSKLGCKNAFAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD++I+SG VR V+VIG++  SRI+DW DRSTCVLFGDGAGA++L       S+  D+
Sbjct: 121 SIADNFIKSGQVRTVLVIGAEIMSRILDWQDRSTCVLFGDGAGAIVLS-----SSTEDDS 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ST L SDG++ D LY  GG + +   G I M G  VF++A+EK    I ++     L
Sbjct: 176 GIISTNLHSDGTFHDLLYTSGGTAYNGVAGTICMNGTVVFEHAIEKLSASILEILSQNDL 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            I +IDWFV HQAN RII  +  ++KIP++K+IV++D H NTSAASIPLAL  A   G++
Sbjct: 236 EICDIDWFVLHQANIRIIELVARRLKIPYEKMIVSIDQHANTSAASIPLALYYARSSGKL 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KK D  +L A+GGG T GT L+R
Sbjct: 296 KKHDVAVLAAIGGGLTWGTCLVR 318


>gi|84687533|ref|ZP_01015409.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664442|gb|EAQ10930.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Rhodobacterales
           bacterium HTCC2654]
          Length = 319

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 169/319 (52%), Positives = 218/319 (68%), Gaps = 1/319 (0%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           VRG+G  LP R++ NS  E  +DTSD WI+ R GI RRH A + ETT+ +  AAA++AL 
Sbjct: 2   VRGVGHYLPERIVPNSWFEERIDTSDDWIRSRSGIERRHFAAEGETTSQMAIAAAKEALR 61

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A M VD +D +IVATSTPD TFPS A  +Q  LGM +GFAFD+QAVC+GFV+A+  A++
Sbjct: 62  DAGMGVDQVDTVIVATSTPDLTFPSCATMVQAGLGMTKGFAFDVQAVCAGFVFALANANA 121

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
            I SG  + V+VIG++TFSRI+D  DRSTCVLFGDGAGAL++E     G +  D GILS+
Sbjct: 122 LIVSGQSKCVLVIGAETFSRILDMEDRSTCVLFGDGAGALLIEAATGTGEN-TDRGILSS 180

Query: 186 YLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENI 245
            L SDG Y + LYVDGG ST+ T G +RM+G  +F+ AVEK     +        T  ++
Sbjct: 181 DLNSDGRYREMLYVDGGVSTTGTAGKLRMQGNPLFRQAVEKLAATADAALGKAGFTHTDV 240

Query: 246 DWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDC 305
           DW VPHQAN RII     K+ +  D V+VTV  HGNTSAASIPLAL    K G++++ D 
Sbjct: 241 DWIVPHQANIRIIQGTAKKLDMSMDNVVVTVQDHGNTSAASIPLALYEGKKRGQIRENDV 300

Query: 306 LLLEAMGGGFTSGTVLLRW 324
           ++ EA+GGG   G V+LRW
Sbjct: 301 VVTEAIGGGLAWGAVVLRW 319


>gi|220935080|ref|YP_002513979.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254783838|sp|B8GSX7|FABH_THISH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|219996390|gb|ACL72992.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 322

 Score =  334 bits (857), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 169/329 (51%), Positives = 228/329 (69%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP ++L+N DLE +V+T+D WI+ R GI +RH+AG +ETT  L E AA
Sbjct: 1   MTYARITGTGGCLPEKILTNHDLEKMVETTDEWIQERTGIKKRHVAGPEETTCDLAERAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A  S  DIDLIIVAT+TPD+ FPSTA  +Q RL +    AFD+QAVC+GFVYA+
Sbjct: 61  RRAMEMAGRSSADIDLIIVATTTPDRVFPSTACLLQKRLEIHGCAAFDVQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD +IR+G  +  +V+G++T SRIVDW+DR+TCVLFGDGAGA++LE  E       + 
Sbjct: 121 GVADRFIRTGGAKCALVVGAETLSRIVDWTDRTTCVLFGDGAGAVVLEASE-------EQ 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRT-----VGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST+L +DG + + L+V  G ST+ +        I M+G  VFK AV     ++++  
Sbjct: 174 GILSTHLHADGRFDNLLHVPKGISTAYSEVLAGEAYIEMKGNEVFKVAVNTLGRIVDETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           +   +    IDW +PHQAN RII +   K+K+P D+V+VTVD HGNTSAASIPLAL VAV
Sbjct: 234 EYNDIDQAEIDWLIPHQANIRIIQATARKLKMPMDRVVVTVDEHGNTSAASIPLALDVAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GRV+ GD L++EA GGGFT G+ LLR+
Sbjct: 294 RDGRVRPGDLLMMEAFGGGFTWGSALLRF 322


>gi|94495939|ref|ZP_01302518.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sphingomonas sp.
           SKA58]
 gi|94424631|gb|EAT09653.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sphingomonas sp.
           SKA58]
          Length = 326

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 235/322 (72%), Gaps = 1/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G +LP+RV++N++L   VDTSD WI  R GI  RHIAG+ ETTA+L   AA+ 
Sbjct: 4   RSILLGTGSALPKRVVTNAELTETVDTSDEWIVERTGIRMRHIAGEGETTATLATDAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A ++  DIDLII+AT+TPDQTFP++A  +Q  LG+    AFD+ AVCSGF+YAVT 
Sbjct: 64  ALEAAGLAAQDIDLIILATATPDQTFPASATKVQAALGIDDCVAFDVAAVCSGFLYAVTV 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS-SMADTG 181
           ADS IRSG  +  +VIGS+TFSRI+DW DR+TCVLFGDGAGA++L   E   +   +  G
Sbjct: 124 ADSMIRSGAAQHALVIGSETFSRILDWEDRTTCVLFGDGAGAIVLGAEESAATDPRSARG 183

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL++ L +DG +   LYVDGGPST+ TVG +RM+G+ VF++AV     ++ +V     L 
Sbjct: 184 ILASKLHADGRHNQLLYVDGGPSTTGTVGKLRMKGQEVFRHAVVNLASVLNEVMSLAGLD 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW VPHQAN RI+++   K+K+P ++VIVTVD H NTSAAS+PLAL +A+++GR+K
Sbjct: 244 ARDIDWLVPHQANARILDATARKLKLPAERVIVTVDRHANTSAASVPLALDLAMRDGRIK 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
            GD ++LEAMGGGFT G  +LR
Sbjct: 304 AGDLVVLEAMGGGFTWGACVLR 325


>gi|302383008|ref|YP_003818831.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193636|gb|ADL01208.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 325

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 225/323 (69%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRS V G+G  LP +V++N +L   VDTSD WI  R GI +RH A  DE T+ L   AA
Sbjct: 3   VIRSAVTGVGSYLPEQVVTNEELSKTVDTSDEWIIERTGIRQRHKARDDEPTSDLATEAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A  +  D+D+IIVAT+TPD TFP+TA  +Q +LG     AFD+QAVCSGFVYA+
Sbjct: 63  RRALADAGRTAADVDMIIVATTTPDMTFPATASIVQRKLGAPVCIAFDVQAVCSGFVYAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++  G+ +  +VIG++  +R++DW+DR+TCVLFGDGAGA+++E  E +G+S AD 
Sbjct: 123 SVADGFVARGLSKCALVIGAEEMTRLMDWTDRTTCVLFGDGAGAVVVEPREGQGTS-ADQ 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GIL   L SDG+  D LYVDGGP+T+ TVG +RM G  VF++AV    E I     +  +
Sbjct: 182 GILGFALRSDGTKTDLLYVDGGPATTGTVGHLRMAGNQVFRHAVVNIAEAITGACAAAGI 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T+  +DWFVPHQAN RII  + D++ +   KVI TV +H NTSAASIPLAL  A+++GR+
Sbjct: 242 TVPEVDWFVPHQANQRIIKGVGDRLGLDEHKVISTVAMHANTSAASIPLALDTAIRDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           ++GD +LLEAMGGG T G    R
Sbjct: 302 RRGDLVLLEAMGGGLTWGACAFR 324


>gi|163735833|ref|ZP_02143262.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter
           litoralis Och 149]
 gi|161390919|gb|EDQ15259.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter
           litoralis Och 149]
          Length = 323

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 230/323 (71%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G+G  LP RV+ NS+ E  +DT+D WI+ R GI RRH A + ETTAS+  AA+R
Sbjct: 3   LRAVVTGVGHYLPDRVVPNSEFEKTLDTNDEWIRARSGIERRHFAAEGETTASMASAASR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   D+D IIVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFV+A++
Sbjct: 63  AALAMAGVEPQDVDAIIVATSTADLTFPSAATMVQAELGMTRGFAFDVQAVCAGFVFALS 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  +RV+VIG++TFSRI+DW+DRSTCVLFGDGAGA++LE  +  G+S AD G
Sbjct: 123 NANALILSGQAKRVLVIGAETFSRIMDWTDRSTCVLFGDGAGAVLLEVQDGTGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST L SDG + D LYVDGG ST  T G +RM+G  VF++AVEK         +   +T
Sbjct: 182 ILSTDLNSDGRHKDLLYVDGGVSTG-TTGYLRMQGNQVFRHAVEKLASTATTALERAGVT 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     K+ +  D+V+VTV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 AADVDWVVPHQANIRIIQGTAKKLGVSMDRVVVTVQDHGNTSAASIPLALSVGHARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++ EA+GGG   G V+LRW
Sbjct: 301 QGDLVVTEAIGGGLAWGAVVLRW 323


>gi|110680343|ref|YP_683350.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter
           denitrificans OCh 114]
 gi|123361737|sp|Q164C9|FABH_ROSDO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|109456459|gb|ABG32664.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter
           denitrificans OCh 114]
          Length = 323

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 228/323 (70%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G+G  LP R++ NS+ E  +DT+D WI+ R GI RRH A + ETTAS+  AA+R
Sbjct: 3   LRAVVTGVGHYLPDRIVPNSEFEKTLDTNDEWIRARSGIERRHFAAEGETTASMAAAASR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A     D+D IIVATST D TFPS A  +Q  LGM RGFAFD+QAVC+GFV+A++
Sbjct: 63  AALSMAGAEAQDVDAIIVATSTADLTFPSAATMVQAELGMTRGFAFDVQAVCAGFVFALS 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  RRV+VIG++ FSRI+DW+DRSTCVLFGDGAGA++LE  +  G+S AD G
Sbjct: 123 NANALILSGQARRVLVIGAEAFSRIMDWTDRSTCVLFGDGAGAVLLEAQDGTGTS-ADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST L SDG + D LYVDGG ST  T G +RM+G  VF++AVEK         +   ++
Sbjct: 182 ILSTDLNSDGRHKDLLYVDGGVSTG-TTGYLRMQGNQVFRHAVEKLAATATTALERAGVS 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW VPHQAN RII     K+ +  D+V+VTV  HGNTSAASIPLAL+V    G++K
Sbjct: 241 ASDVDWVVPHQANIRIIQGTAKKLGVSMDRVVVTVQDHGNTSAASIPLALSVGHARGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD ++ EA+GGG   G V+LRW
Sbjct: 301 QGDLVVTEAIGGGLAWGAVVLRW 323


>gi|83942552|ref|ZP_00955013.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfitobacter sp.
           EE-36]
 gi|83846645|gb|EAP84521.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfitobacter sp.
           EE-36]
          Length = 323

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/322 (54%), Positives = 228/322 (70%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G G  LP RV+ N++ E  +DTSD WI+ R GI RRH  G+ ETT+++  AAA+ 
Sbjct: 4   RAVVIGAGHYLPERVVENAEFEGKIDTSDEWIRSRSGIERRHFVGEGETTSTMATAAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  +  D+D +IVATSTPD TFPS A  +Q +L M+RGFAFD+QAVC+GFVYA+  
Sbjct: 64  ALADAGKTAADVDAVIVATSTPDLTFPSAATMVQAQLEMERGFAFDVQAVCAGFVYALAN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIGS+TFS+I+DW+DRST VLFGDGAGA++LE  +  G++ AD GI
Sbjct: 124 ANALIVSGQADRVLVIGSETFSKIMDWTDRSTSVLFGDGAGAILLEAQDGDGTA-ADHGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         D   ++ 
Sbjct: 183 LSTDLNSDGRYKDLLYVDGGISTG-TTGYLRMQGNQVFRHAVEKLAASANTAMDRAGVSA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           E++DW VPHQAN RII     K+ +  D V+VTV  HGNTSAASIPLAL+V  + G++KK
Sbjct: 242 EDVDWIVPHQANIRIIQGTAKKLNLSMDNVVVTVQDHGNTSAASIPLALSVGQERGQIKK 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD L+ EA+GGG   G ++LRW
Sbjct: 302 GDLLVTEAIGGGLAWGAIVLRW 323


>gi|83953773|ref|ZP_00962494.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfitobacter sp.
           NAS-14.1]
 gi|83841718|gb|EAP80887.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfitobacter sp.
           NAS-14.1]
          Length = 323

 Score =  333 bits (853), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 176/322 (54%), Positives = 228/322 (70%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G G  LP R++ N++ E  +DTSD WI+ R GI RRH  G+ ETT+++  AAA+ 
Sbjct: 4   RAVVIGAGHYLPERIVENAEFEGKIDTSDEWIRSRSGIERRHFVGEGETTSTMATAAAKA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  +  D+D +IVATSTPD TFPS A  +Q +L M+RGFAFD+QAVC+GFVYA+  
Sbjct: 64  ALADAGKTAADVDAVIVATSTPDLTFPSAATMVQAQLEMERGFAFDVQAVCAGFVYALAN 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A++ I SG   RV+VIGS+TFS+I+DW+DRST VLFGDGAGA++LE  +  G++ AD GI
Sbjct: 124 ANALIVSGQADRVLVIGSETFSKIMDWTDRSTSVLFGDGAGAILLEAQDGAGTA-ADRGI 182

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           LST L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         D   ++ 
Sbjct: 183 LSTDLNSDGRYKDLLYVDGGISTG-TTGYLRMQGNQVFRHAVEKLAASANTAMDRAGVSA 241

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           E++DW VPHQAN RII     K+ +  D V+VTV  HGNTSAASIPLAL+V  + G++KK
Sbjct: 242 EDVDWIVPHQANIRIIQGTAKKLNLSMDNVVVTVQDHGNTSAASIPLALSVGQERGQIKK 301

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD L+ EA+GGG   G ++LRW
Sbjct: 302 GDLLVTEAIGGGLAWGAIVLRW 323


>gi|85709151|ref|ZP_01040217.1| 3-oxoacyl-(acyl carrier protein) synthase [Erythrobacter sp. NAP1]
 gi|85690685|gb|EAQ30688.1| 3-oxoacyl-(acyl carrier protein) synthase [Erythrobacter sp. NAP1]
          Length = 325

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 237/324 (73%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G +LP+R+++N++L   VDTSD WI  R GI +RHIAG  ETTA+L  AAA
Sbjct: 1   MTGSRIVGSGSALPQRIVTNNELAERVDTSDEWIIERTGIRQRHIAGAGETTATLATAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +   DIDLI++AT+TPD TFP+TA  +Q+ LG K G AFD+ AVCSGF+YA+
Sbjct: 61  RAALADAGLKAGDIDLIVLATATPDNTFPATATKVQHALGCKNGPAFDVGAVCSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA-D 179
           TTADS + +G   R +VIG++TFSRI+DW DR+TCVLFGDGAGA++LE  +    + A  
Sbjct: 121 TTADSLLATGSANRALVIGAETFSRILDWEDRTTCVLFGDGAGAVVLEAPDAANPAKAGG 180

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            G+L++ L +DG+  D LYVDGGPS+++TVG +RM+G  VF++AV     ++++V +   
Sbjct: 181 PGVLASRLHADGAQHDLLYVDGGPSSTQTVGHLRMKGPEVFRHAVVNLSSVLKEVIEDAD 240

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           ++  +IDW VPHQAN RI+++   K+ IP +KV+VTVD H NTSAAS+PLA  VA K+GR
Sbjct: 241 VSASDIDWIVPHQANKRILDATARKLGIPDEKVVVTVDKHANTSAASVPLAFDVARKDGR 300

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           +K GD ++ EAMGGGFT G  L+R
Sbjct: 301 IKAGDLVMFEAMGGGFTWGASLVR 324


>gi|315499914|ref|YP_004088717.1| 3-oxoacyl-(acyl-carrier-protein) synthase iii [Asticcacaulis
           excentricus CB 48]
 gi|315417926|gb|ADU14566.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Asticcacaulis
           excentricus CB 48]
          Length = 326

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 225/322 (69%), Gaps = 2/322 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ V G+G  LP  VLSN D   +VDT+D WI  R GI +RH AG D+ T+ L   AA+ 
Sbjct: 5   RTAVTGVGGYLPETVLSNEDFTRMVDTTDEWIVARTGIRKRHKAGDDQLTSDLAVEAAKI 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A  +++DIDLIIVAT+TPD TFPSTA  +Q +LG+ RG AFD+QAVCSGFVYA++ 
Sbjct: 65  ALEAAGRTIEDIDLIIVATTTPDMTFPSTASIVQAKLGVPRGAAFDVQAVCSGFVYALSV 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD ++  G+ +  +VIG++  SRI+D++DRSTC+LFGDGAGA++LE  + +G++  DTGI
Sbjct: 125 ADGFVARGLSKCALVIGAEVMSRILDYTDRSTCILFGDGAGAVVLEAAQGQGTA-EDTGI 183

Query: 183 LSTYLCSDGSYIDKLYVDGGP-STSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           LS  L  DGS  D LYVDGG   + R VG IRM+G  VFK+AV+K  E  E       L 
Sbjct: 184 LSFDLQCDGSKTDLLYVDGGVFDSGRHVGKIRMQGNQVFKHAVQKISEAAESAMHKAGLD 243

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            + +DWF+PHQAN RI++ + D++ +  +KVI TV  H NTSAASIPLA    +++GRVK
Sbjct: 244 HQAVDWFIPHQANQRILDGVADRLGLDREKVISTVAEHANTSAASIPLAWYAGIQDGRVK 303

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
           KGD +L+EA+GGG T     +R
Sbjct: 304 KGDLVLIEALGGGLTWAAAAIR 325


>gi|209545406|ref|YP_002277635.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533083|gb|ACI53020.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 327

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 229/324 (70%), Gaps = 5/324 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G  LP R+++N +L + ++TSD WI+ R GI++RHIAG  +T  S+  AA   
Sbjct: 5   RSLLVGFGGYLPDRIVTNDELAARLETSDEWIRARTGITQRHIAGPHDTAVSMAAAAGAR 64

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A M+  D+  IIVATSTPDQ FPSTAV +Q  LG++ GF FD+ A CSGFVYA++ 
Sbjct: 65  ALDYAGMAAADVGAIIVATSTPDQAFPSTAVRVQAELGLRGGFGFDIAAACSGFVYALSM 124

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT-- 180
           ADS IRSG V  V+VIGS+ +SRI+DWSDR TCVLFGDGAGA++L+  +  G    DT  
Sbjct: 125 ADSLIRSGQVDSVLVIGSEVYSRILDWSDRGTCVLFGDGAGAVLLKAAD--GPEPGDTRP 182

Query: 181 -GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            GILST+L SDGS  D LYVDG      + G +RM G+ VF++AV K    +++V  +  
Sbjct: 183 QGILSTHLHSDGSSGDLLYVDGAIGLRESSGFLRMRGRDVFRHAVAKLSSSVDEVLHANG 242

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT  +++W VPHQAN RII  +  K+++P ++V+VTVD H NTSAASIPLA+  AV++GR
Sbjct: 243 LTYADVNWLVPHQANLRIIEGVARKLELPPERVVVTVDRHANTSAASIPLAMNEAVRDGR 302

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ GD +L+EA+GGG T G+ L R
Sbjct: 303 IRPGDLVLMEALGGGLTWGSALAR 326


>gi|294677448|ref|YP_003578063.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodobacter
           capsulatus SB 1003]
 gi|294476268|gb|ADE85656.1| 3-oxoacyl-[acyl-carrier-protein] synthase III-2 [Rhodobacter
           capsulatus SB 1003]
          Length = 324

 Score =  332 bits (851), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 225/323 (69%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ N++ E  +DT+D WI+ R GI RRH A + ETT+ L   AA 
Sbjct: 3   IRAVVRGVGHYLPARVVENAEFEGKLDTTDEWIRSRTGIERRHFAAEGETTSQLAIKAAA 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DID I+VATSTPD TFPS A  +Q  LG    FAFD+QAVC+GFV+A+ 
Sbjct: 63  AALADAGLSAADIDAIVVATSTPDFTFPSVATMVQAGLGNTNAFAFDVQAVCAGFVFALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+  I SG  +RV+VIG++TFSRI+DW+DR TCVLFGDGAGALILE       + AD G
Sbjct: 123 NANGMILSGQAKRVLVIGAETFSRIMDWADRGTCVLFGDGAGALILE-AAEGAGTAADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL++ L SDG Y + LYVDGG ST+   G +RM+G AVFK+AV+K  E          LT
Sbjct: 182 ILASDLHSDGRYRELLYVDGGVSTNGQSGHLRMQGNAVFKHAVQKLAETAHAALAKAGLT 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++ W VPHQAN RII +  ++M +P ++V+VTV  HGNTSAASIPLAL+ A   G++K
Sbjct: 242 PEDVSWIVPHQANLRIITATAERMGVPMERVVVTVADHGNTSAASIPLALSTARARGQIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD ++ EA+GGG   G+V+LRW
Sbjct: 302 AGDLIVTEAIGGGLAWGSVVLRW 324


>gi|162148846|ref|YP_001603307.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 (3-oxoacyl
           [acyl-carrier-protein] synthase III) (beta-ketoacyl-ACP
           synthase III (KAS III) [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161787423|emb|CAP57018.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase 3 (3-oxoacyl
           [acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP
           synthase III (KAS III) [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 341

 Score =  332 bits (850), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 229/324 (70%), Gaps = 5/324 (1%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G  LP R+++N +L + ++TSD WI+ R GI++RHIAG  +T  S+  AA   
Sbjct: 19  RSLLVGFGGYLPDRIVTNDELAARLETSDEWIRARTGITQRHIAGPHDTAVSMAAAAGAR 78

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A M+  D+  IIVATSTPDQ FPSTAV +Q  LG++ GF FD+ A CSGFVYA++ 
Sbjct: 79  ALDYAGMAAADVGAIIVATSTPDQAFPSTAVRVQAELGLRGGFGFDIAAACSGFVYALSM 138

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT-- 180
           ADS IRSG V  V+VIGS+ +SRI+DWSDR TCVLFGDGAGA++L+  +  G    DT  
Sbjct: 139 ADSLIRSGQVDSVLVIGSEVYSRILDWSDRGTCVLFGDGAGAVLLKAAD--GPEPGDTRP 196

Query: 181 -GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            GILST+L SDGS  D LYVDG      + G +RM G+ VF++AV K    +++V  +  
Sbjct: 197 KGILSTHLHSDGSTGDLLYVDGAIGLRESSGFLRMRGRDVFRHAVAKLSSSVDEVLHANG 256

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT  +++W VPHQAN RII  +  K+++P ++V+VTVD H NTSAASIPLA+  AV++GR
Sbjct: 257 LTYADVNWLVPHQANLRIIEGVARKLELPPERVVVTVDRHANTSAASIPLAMNEAVRDGR 316

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ GD +L+EA+GGG T G+ L R
Sbjct: 317 IRPGDLVLMEALGGGLTWGSALAR 340


>gi|167646995|ref|YP_001684658.1| 3-oxoacyl-(acyl carrier protein) synthase III [Caulobacter sp. K31]
 gi|167349425|gb|ABZ72160.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caulobacter sp. K31]
          Length = 325

 Score =  332 bits (850), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 167/323 (51%), Positives = 220/323 (68%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRS V G+G  LP  V++NS L   VDTSD WI  R GI +RH+   D+  + L   AA
Sbjct: 3   VIRSAVTGVGAYLPDNVVTNSQLAETVDTSDEWIVERTGIRQRHMVADDQPVSDLAFRAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A  +  D+DLIIVAT+TPD TFP+TA  +Q +LG   G AFD+QAVCSGFVYA+
Sbjct: 63  QQALERAGKTAADVDLIIVATTTPDMTFPATAAIVQRKLGAPVGIAFDIQAVCSGFVYAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++  G  +  +VIG++  +R++DW+DR TCVLFGDGAGA++LE  E +G++ AD 
Sbjct: 123 SVADGFVARGQAKCALVIGAEAMTRLMDWTDRGTCVLFGDGAGAVVLEPREGQGTT-ADQ 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L   L +DG+  + LYVDGGPST+ TVG +RM G  VFK+AV    E I     +  +
Sbjct: 182 GLLGFALRADGTKQELLYVDGGPSTTGTVGKLRMLGNQVFKHAVINISEAIHAAAAAAGV 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           TI  +DWF+PHQAN RI+  +  ++ I  DKVI TV +H NTSAASIPLA A  + +GR+
Sbjct: 242 TIPEVDWFIPHQANQRILAGVAHRVGIDEDKVISTVALHANTSAASIPLAFAQGIADGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K G  LLLEAMGGG T G  +LR
Sbjct: 302 KPGQLLLLEAMGGGLTWGACVLR 324


>gi|329889488|ref|ZP_08267831.1| 3-oxoacyl-acyl-carrier-protein synthase 3 family protein
           [Brevundimonas diminuta ATCC 11568]
 gi|328844789|gb|EGF94353.1| 3-oxoacyl-acyl-carrier-protein synthase 3 family protein
           [Brevundimonas diminuta ATCC 11568]
          Length = 325

 Score =  332 bits (850), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 171/324 (52%), Positives = 225/324 (69%), Gaps = 1/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IRS V G+G  LP +V++N+DL  IVDTSD WI  R GI +RH A  DE T+ L   AA
Sbjct: 3   VIRSVVTGVGSFLPEQVVTNADLTKIVDTSDEWIIERTGIRQRHKARDDEPTSDLALKAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A  +  D+DLIIVAT+TPDQTFP+TA  +Q +LG   G AFD+QAVCSGFVYA+
Sbjct: 63  ERALADAGKTAADVDLIIVATTTPDQTFPATAAIVQRKLGAPVGIAFDVQAVCSGFVYAM 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++  G  +  +VIG++  ++++DW+DR+TCVLFGDGAGA +LE  E +G+   D 
Sbjct: 123 SVADGFVARGQAKCALVIGAEEMTKLMDWTDRTTCVLFGDGAGAFVLEPGEGQGTK-DDR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L   L  +G+  D LYVDGGP+T+ TVG +RM G  VF++AV    E I    +   +
Sbjct: 182 GVLGFALRCEGAKADMLYVDGGPATTGTVGHLRMLGNQVFRHAVVNIAEAITAAAEVAGV 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            I  IDWFVPHQAN RII  + D++ +  DKVI TV +H NTSAASIPLA+ VA+K+GR+
Sbjct: 242 DIPEIDWFVPHQANQRIIKGVGDRLGLDEDKVISTVAMHANTSAASIPLAMDVAIKDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGD +L+EAMGGG T G    R+
Sbjct: 302 KKGDLVLVEAMGGGLTWGACAFRF 325


>gi|42520798|ref|NP_966713.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|59797815|sp|Q73GG9|FABH_WOLPM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|42410538|gb|AAS14647.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Drosophila melanogaster]
          Length = 318

 Score =  331 bits (849), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 232/325 (71%), Gaps = 8/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M +S +   G  LPR++LSN+++ SIV+TSD WI++R GI +RHIA + E T+ L   AA
Sbjct: 1   MNKSFILSTGSYLPRKMLSNNEIASIVETSDEWIRQRTGIVQRHIADEGELTSDLAVNAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+  A++SVD+IDLIIVAT+TPD+TFPS A  +Q++L  K  FAFD+QA CSGF+YAV
Sbjct: 61  KSAIEKAKISVDEIDLIIVATTTPDKTFPSCATIVQSKLKCKNAFAFDVQAACSGFIYAV 120

Query: 121 TTADSYIRSGV-VRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           T ADS I+S   ++  +VIG++  SRIVDW DRSTCVLFGDGAGA++++      S M  
Sbjct: 121 TVADSLIKSNNRIKYALVIGAEIMSRIVDWEDRSTCVLFGDGAGAVVMK------SEMGR 174

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           +GI+ST L SDG+ +D L  +GG S++   G I M G+ VFK+AV+K    +E+     +
Sbjct: 175 SGIISTNLYSDGN-VDILCTNGGISSTGDSGKICMNGREVFKHAVDKLTASVEETLKCNN 233

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L I +IDW +PHQAN RII ++V K+  P +KVI TVD H NTSAASIPLAL  A++E +
Sbjct: 234 LKITDIDWLIPHQANIRIIEAVVKKLDFPIEKVINTVDKHANTSAASIPLALDYAIQESK 293

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +K G+ +LL ++G G T G+VLL +
Sbjct: 294 IKSGNLVLLISIGAGLTWGSVLLHY 318


>gi|325981366|ref|YP_004293768.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosomonas sp.
           AL212]
 gi|325530885|gb|ADZ25606.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosomonas sp.
           AL212]
          Length = 319

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 226/326 (69%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+ S + G G  LP +VL+N DLE +VDTSD WI+ R GI++RHIA +D+  + L   A 
Sbjct: 1   MMYSRITGTGSYLPEKVLTNLDLERMVDTSDEWIRTRTGITQRHIAAEDQVASDLALYAC 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++A+  A ++  DIDLIIVAT+TPD  FPSTA  +QN+LG++   AFD+QAVCSGFVYA+
Sbjct: 61  QNAMQAAGVTGKDIDLIIVATTTPDMIFPSTACILQNKLGIENCPAFDVQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD ++ SG  R  +V+GS+ +S+I+DWSDRSTCVLFGDGAGA++L       S     
Sbjct: 121 ATADMFVSSGRCRNALVVGSEIYSKILDWSDRSTCVLFGDGAGAVVL-------SRSDRP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GILST+L + GS+ + L   G  S  +  G   I MEG AVFK+AV+   E++ +     
Sbjct: 174 GILSTHLHASGSHSNILSAPGCISGGKVHGTPYINMEGNAVFKFAVKVLEEVVHEAVAEN 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           +L   +IDW +PHQAN RII S   K+ +P +KV+V VD HGNTSAASIPLAL +AV++G
Sbjct: 234 NLQSTDIDWLIPHQANIRIIQSTAKKLGLPMEKVVVAVDKHGNTSAASIPLALDMAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R++    +L+E +GGGFT G VLLRW
Sbjct: 294 RIQPDQLILMEGVGGGFTWGAVLLRW 319


>gi|401573|sp|P30790|FABH_RHOCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|151943|gb|AAA26127.1| ORF3; putative [Rhodobacter capsulatus]
          Length = 324

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/323 (53%), Positives = 225/323 (69%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           IR+ VRG+G  LP RV+ N++ E  +DT+D WI+ R GI RRH A + ETT+ L   AA 
Sbjct: 3   IRAVVRGVGHYLPARVVENAEFEGKLDTTDEWIRSRTGIERRHFAAEGETTSQLAIKAAA 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S  DID I+VATSTPD TFPS A  +Q  LG    FAFD+QAVC+GFV+A+ 
Sbjct: 63  AALADAGLSAADIDAIVVATSTPDFTFPSVATMVQAGLGNTNAFAFDVQAVCAGFVFALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+  I SG  +RV+VIG++TFSRI+DW+DR TCVLFGDGAGA+ILE       + AD G
Sbjct: 123 NANGMILSGQAKRVLVIGAETFSRIMDWADRGTCVLFGDGAGAVILE-AAEGAGTAADRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           IL++ L SDG Y + LYVDGG ST+   G +RM+G AVFK+AV+K  E          LT
Sbjct: 182 ILASDLHSDGRYRELLYVDGGVSTNGQSGHLRMQGNAVFKHAVQKLAETAHAALAKAGLT 241

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E++ W VPHQAN RII +  ++M +P ++V+VTV  HGNTSAASIPLAL+ A   G++K
Sbjct: 242 PEDVSWIVPHQANLRIITATAERMGVPMERVVVTVADHGNTSAASIPLALSTARARGQIK 301

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            GD ++ EA+GGG   G+V+LRW
Sbjct: 302 AGDLIVTEAIGGGLAWGSVVLRW 324


>gi|126666473|ref|ZP_01737452.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter sp. ELB17]
 gi|126629274|gb|EAZ99892.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter sp. ELB17]
          Length = 322

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 167/329 (50%), Positives = 229/329 (69%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP ++++N DLE IVDT+D WI+ R GI +RHIA K +TT  L E AA
Sbjct: 1   MTFARITGTGSYLPDQIVTNKDLEKIVDTTDQWIRERTGIEQRHIAVKGQTTVDLAEQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A ++  DIDLI+ ATSTP++ FPS+A  +Q RLG++   AFD+QAVCSGFVYA+
Sbjct: 61  LRAIEAAGINAADIDLIVFATSTPNKVFPSSACILQARLGIRGCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD +I++G  ++V+VIG++ FSRI+DWSDR TCVLFGDGAGA+ILE  +       +T
Sbjct: 121 ATADKFIKTGTSKKVLVIGAEVFSRIIDWSDRGTCVLFGDGAGAVILEASD-------ET 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRT-VGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST+L +DGSY   L+V  G    P   +  +G + M+G  VF+ AV     ++++  
Sbjct: 174 GILSTHLHADGSYEKLLHVPCGIAENPEKFKAGLGYVEMKGNEVFRMAVNTLGRIVDETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
              ++   +IDW VPHQAN RII +   K+ +P D+V+VTV  HGNTSAASIPLAL  AV
Sbjct: 234 AHNNMKKSDIDWLVPHQANMRIIAATARKLNMPMDQVVVTVHKHGNTSAASIPLALDEAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR+K+ + +LLEA GGGFT G+ LLR+
Sbjct: 294 RDGRIKRNEVVLLEAFGGGFTWGSALLRF 322


>gi|294013225|ref|YP_003546685.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sphingobium
           japonicum UT26S]
 gi|292676555|dbj|BAI98073.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Sphingobium
           japonicum UT26S]
          Length = 322

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 177/321 (55%), Positives = 235/321 (73%), Gaps = 3/321 (0%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G +LP R +SN++L   VDTSD WI  R GI  R+IAG+ ETTA+L   AAR 
Sbjct: 4   RSILLGTGSALPARAVSNAELAETVDTSDEWIVERTGIRTRYIAGEGETTATLATDAARA 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A ++  DIDLII+AT+TPDQTFP++A  +Q  LG+    AFD+ AVCSGF+YAVT 
Sbjct: 64  ALEAAGIAASDIDLIILATATPDQTFPASATIVQAALGIDDCVAFDVAAVCSGFLYAVTV 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS IRSG  R  +VIGS+TFSRI+DW DR+TCVLFGDGAGA++L   E   S+    GI
Sbjct: 124 ADSMIRSGAARNAIVIGSETFSRILDWEDRTTCVLFGDGAGAVVLGAEE---SADGRRGI 180

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           L++ L +DG +   LYVDGGPST++TVG +RM+G+ VF++AV     ++ +V  +  +T 
Sbjct: 181 LASKLHADGRHNQLLYVDGGPSTTQTVGKLRMKGQEVFRHAVTNLASVLTEVMAAADMTP 240

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDW VPHQAN RI+++   K+K+  +KV++TVD H NTSAAS+PLAL +A+++GR+K 
Sbjct: 241 ADIDWLVPHQANARILDATARKLKLSPEKVVMTVDRHANTSAASVPLALDLAMRDGRIKS 300

Query: 303 GDCLLLEAMGGGFTSGTVLLR 323
           GD L+LEAMGGGFT G  +LR
Sbjct: 301 GDLLVLEAMGGGFTWGACVLR 321


>gi|78485055|ref|YP_390980.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thiomicrospira
           crunogena XCL-2]
 gi|78363341|gb|ABB41306.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Thiomicrospira
           crunogena XCL-2]
          Length = 325

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 226/328 (68%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP ++++N DLE IVDTSD WI+ R GI  R IA + ETT  L E A+ 
Sbjct: 5   IYSRIVGTGGYLPEKIMTNIDLEKIVDTSDEWIRERTGIEERRIAAEQETTCDLAEKASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   DI+LI+VAT+TPD+ FPSTA  +Q+RLG +   AFD+QAVC+GFVYA++
Sbjct: 65  QALEMAGLEGKDIELILVATTTPDKIFPSTATLLQHRLGNRGAPAFDLQAVCTGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD YI++G+ +RV+V+G++T SRI +W+DR+TCVLFGDGAGA++LE       +  +TG
Sbjct: 125 VADQYIKNGMYKRVLVVGAETLSRITNWNDRNTCVLFGDGAGAVVLE-------ASTETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTV-----GCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST++ +DG Y + L+V  GPS            + M+G  VFK AV    ++  +  D
Sbjct: 178 ILSTHIHADGQYEELLHVPSGPSKLPQTDDVAEKTMSMKGNEVFKVAVNTLSKIATETLD 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  +  E++DW VPHQAN RII +   K+K+  D+ ++TV+ H NTS+ASIPLAL  AV+
Sbjct: 238 ANQMQKEDLDWLVPHQANLRIIKATAKKLKLGDDQTVITVNKHANTSSASIPLALNEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           +GR++KG  LLLEA GGGFT G+ L+++
Sbjct: 298 DGRIQKGQTLLLEAFGGGFTWGSALVKF 325


>gi|311694516|gb|ADP97389.1| 3-oxoacyl-(acyl carrier protein) synthase III [marine bacterium
           HP15]
          Length = 322

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 165/329 (50%), Positives = 227/329 (68%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP  +++N DLE +VDT+D WI+ R GI RRHIA + +TT  L E AA
Sbjct: 1   MTFARITGTGSYLPENIVTNKDLEKMVDTTDQWIRERTGIERRHIAVEGQTTVDLAEQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R+A+  A ++  DIDLI+ ATSTPD+ FPS+A  +Q RLG+    AFD+QAVCSGFVYA+
Sbjct: 61  RNAIDAAGINAQDIDLIVFATSTPDKIFPSSACILQARLGIHGCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+ +I++G  ++ +VIG++ FSRI++W DR TCVLFGDGAGA+ILE  E       +T
Sbjct: 121 ATAEKFIKTGSSKKALVIGAEVFSRIINWEDRGTCVLFGDGAGAVILEADE-------ET 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTV-----GCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST++ +DG Y D L+V  G S +          + M+G  VFK AV    +++++  
Sbjct: 174 GILSTHIHADGQYEDLLHVPCGISDNYDQVKAGRAFVEMKGNEVFKVAVNTLGKIVDETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
            +  +    IDW VPHQAN RII++   K+ +  D+V+VTV+ HGNTSAASIPLAL VAV
Sbjct: 234 AANRMQKSEIDWLVPHQANLRIISATAKKLNMSMDQVVVTVNEHGNTSAASIPLALDVAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR+K+ + LLLEA GGGFT G+ LLR+
Sbjct: 294 RDGRIKRNEVLLLEAFGGGFTWGSALLRY 322


>gi|288941609|ref|YP_003443849.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Allochromatium
           vinosum DSM 180]
 gi|288896981|gb|ADC62817.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Allochromatium
           vinosum DSM 180]
          Length = 318

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 228/325 (70%), Gaps = 8/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP RV++N+DLE+IVDT+D WI+ R GI +RH+A + ET   L E AA
Sbjct: 1   MKFSRILGTGGYLPSRVMTNADLEAIVDTTDSWIRERTGIEKRHLASEGETCCDLAEIAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +   D+DLI+VAT+TPDQ FPSTA  +Q RL +    AFD+QAVC+GFVYA+
Sbjct: 61  RRALEAAGLHPADLDLILVATTTPDQFFPSTACLLQQRLDVHGCPAFDLQAVCAGFVYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD YIR+G  + V+V+G++T SR++DW+DR+TCVLFGDGAGA++L   +       + 
Sbjct: 121 DVADKYIRAGAAKHVLVVGAETISRLLDWNDRTTCVLFGDGAGAVVLGAAD-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRT-VGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           GI+ST++ +DG+Y + L V GG    R  +  + M G  VF++AV     ++++  ++  
Sbjct: 174 GIISTHIHADGAYKELLQVPGGHGNGRADLAKLEMRGNEVFRFAVTTLGRIVDETLEANG 233

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT + IDW +PHQAN RII +   K+ +P ++VIVTV  HGNTS+ASIPLA   AV++GR
Sbjct: 234 LTKDAIDWLIPHQANIRIIQATARKLDLPMERVIVTVAEHGNTSSASIPLAFDQAVRDGR 293

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G+ LL+EA GGGFT G+VL+R+
Sbjct: 294 IQRGETLLMEAFGGGFTWGSVLVRY 318


>gi|171315866|ref|ZP_02905096.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria MEX-5]
 gi|171098962|gb|EDT43750.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria MEX-5]
          Length = 330

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 163/321 (50%), Positives = 225/321 (70%), Gaps = 2/321 (0%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S V G G +LP R ++N D+  +VDT+D WI +R GI  R IA   E T+ L   AA  A
Sbjct: 12  SRVVGCGSALPERRVTNHDIARMVDTTDEWITQRTGIKERRIAADGEHTSDLAIGAATAA 71

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +S  D+DLI++AT TPD+T P+TAV +Q  +GM+ G AFD+QAVCSGFV+A++ A
Sbjct: 72  LKQAGISGADVDLIVLATCTPDRTMPATAVRVQEAIGMQGGVAFDVQAVCSGFVFALSVA 131

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D+ IR G  R  +VIG++T SRIVDW DR+TCVLFGDGAGA++L G    G      G+L
Sbjct: 132 DNMIRLGQARTAIVIGAETMSRIVDWQDRNTCVLFGDGAGAVVLRGERTDGDK--PRGVL 189

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L SDG + DK++ DGG S++++ G + +EG+ VF +AV    E  ++   S  LT +
Sbjct: 190 STHLHSDGRHHDKIHTDGGVSSTQSAGKMHLEGRDVFLHAVVNLAEASQEALASHGLTQD 249

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RI+ ++  K+ +P +KV++TV  HGNTSAASIPLAL+ AV +GR+K+ 
Sbjct: 250 DLDWVVPHQANQRIVQTLGVKLNLPMEKVVLTVGKHGNTSAASIPLALSEAVTDGRIKEN 309

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +L+ AMG GFT G+ L+RW
Sbjct: 310 DLVLMPAMGSGFTWGSALIRW 330


>gi|126729746|ref|ZP_01745559.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sagittula stellata
           E-37]
 gi|126709865|gb|EBA08918.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sagittula stellata
           E-37]
          Length = 315

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 166/299 (55%), Positives = 212/299 (70%), Gaps = 2/299 (0%)

Query: 26  IVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPD 85
           +++TSD WI+ R GI RRHIA   +TT+ L   AAR AL  A +S DDID I++ATST D
Sbjct: 19  VLETSDEWIRARSGIERRHIAAPGQTTSDLATRAARVALSDAGISADDIDAIVLATSTAD 78

Query: 86  QTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSR 145
            TFPS A  +Q  LGM +GFAFD+QAVC+GF+YA+  A++ I SG   RV+VIG++TFSR
Sbjct: 79  LTFPSAATMVQAELGMTKGFAFDVQAVCAGFIYALANANALITSGQAERVLVIGAETFSR 138

Query: 146 IVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPST 205
           I+DW+DRSTCVLFGDGAGALILE  E +G++ AD GILS  L SDG + D LYVDGG +T
Sbjct: 139 IMDWTDRSTCVLFGDGAGALILEAREGEGTN-ADRGILSCDLNSDGRFRDILYVDGGVAT 197

Query: 206 SRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKM 265
           + T G +RM GK VF++AVEK         D   +    +DW VPHQAN RII     K+
Sbjct: 198 N-TTGHLRMAGKEVFRHAVEKLASTANTAMDKIGMPSSEVDWVVPHQANIRIIAGTAKKL 256

Query: 266 KIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            +P ++V+VTV  HGNTSAASIPLAL+V    G++ +GD ++ EA+GGG   G V+LRW
Sbjct: 257 GLPMERVVVTVQDHGNTSAASIPLALSVGRARGQISEGDVVVTEAIGGGLAWGAVVLRW 315


>gi|149374888|ref|ZP_01892661.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter algicola
           DG893]
 gi|149360777|gb|EDM49228.1| 3-oxoacyl-(acyl carrier protein) synthase [Marinobacter algicola
           DG893]
          Length = 322

 Score =  328 bits (841), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 164/329 (49%), Positives = 225/329 (68%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP  V++N D+E IVDTSD WI+ R GI +RHIA + ETT  L E A+
Sbjct: 1   MTYARIVGTGSYLPENVMTNEDMEKIVDTSDQWIRERTGIEQRHIAVEGETTVDLAEKAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A +   DIDLI+ ATSTPD+ FPS+A  +Q RL +    AFD+QAVCSGFVYA+
Sbjct: 61  RKAIEAAGLQPADIDLIVFATSTPDKIFPSSACILQARLDIHGCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +I++G  ++V+V+G++ FSRI+DW DR TCVLFGDGAGA++LE  E       +T
Sbjct: 121 SVADKFIKTGSSKKVLVVGAELFSRILDWEDRGTCVLFGDGAGAVVLEASE-------ET 173

Query: 181 GILSTYLCSDGSYIDKLYV-----DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST++ +DG Y D L+V     DG        G + M+G  VFK AV     ++++  
Sbjct: 174 GILSTHIHADGKYEDLLHVPFGIGDGFDQVRAGKGHVHMKGNEVFKIAVNTLGRIVDETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           ++  +   ++DW VPHQAN RII +   K+ +  D+V+VTV+ HGNTSAASIPLAL VAV
Sbjct: 234 EANQMKKSDVDWLVPHQANLRIIAATARKLNMSMDQVVVTVNKHGNTSAASIPLALDVAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR++K + LLLEA GGGFT G+ L+R+
Sbjct: 294 RDGRIQKNEVLLLEAFGGGFTWGSALIRF 322


>gi|30249610|ref|NP_841680.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrosomonas
           europaea ATCC 19718]
 gi|34098451|sp|Q82U60|FABH_NITEU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|30138973|emb|CAD85557.1| fabH; 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrosomonas
           europaea ATCC 19718]
          Length = 318

 Score =  328 bits (841), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 165/323 (51%), Positives = 219/323 (67%), Gaps = 9/323 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S + G G  LP +VL+N DLES+VDTSD WI+ R GI RRHIA + +  + L   A+R+A
Sbjct: 3   SRIIGTGSYLPEKVLTNQDLESMVDTSDEWIRTRTGIERRHIAAEGQMASDLALEASRNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           +  A++   DIDLIIVAT+TPD  FPSTA  +QN+LGM  G AFD+QAVCSGF+YA+ TA
Sbjct: 63  IEAADIQAKDIDLIIVATTTPDMIFPSTACILQNKLGMSNGPAFDVQAVCSGFIYALATA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D ++ SG  R  +V+G++ +SRI+DW+DRSTCVLFGDGAGA+IL       +     GIL
Sbjct: 123 DMFVSSGKARNALVVGAEVYSRIMDWNDRSTCVLFGDGAGAVIL-------TRDQKPGIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           S++L +DGSY   L       + +  G   I MEG  VFK+AV+   E   +   +  L 
Sbjct: 176 SSHLHADGSYSQVLTAPASIHSGKIQGTPFITMEGGTVFKFAVKVLEEAALEALQANQLQ 235

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW +PHQAN RII S   K+ IP +KV+ TV  HGNTSAAS+PLAL  AV++GR++
Sbjct: 236 PSDIDWLIPHQANIRIITSTAKKLGIPEEKVVATVSQHGNTSAASVPLALDQAVRDGRIQ 295

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
               ++LE +GGGFT G+VL+RW
Sbjct: 296 PDQHIVLEGVGGGFTWGSVLVRW 318


>gi|254487266|ref|ZP_05100471.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           GAI101]
 gi|214044135|gb|EEB84773.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           GAI101]
          Length = 323

 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 174/323 (53%), Positives = 226/323 (69%), Gaps = 2/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G G  LP RV+ N++ E  +DT D WI+ R GI RRH    DETT+++  AAA 
Sbjct: 3   LRAVVIGAGHYLPERVVENAEFEGKIDTDDAWIRSRSGIERRHFVSGDETTSTMATAAAL 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A  +  D+D II+ATST D TFPS A  +Q +LGM+ GFAFD+QAVC+GF++A++
Sbjct: 63  AALAQAGKTPADVDAIILATSTADLTFPSAATMVQAQLGMENGFAFDVQAVCAGFIFALS 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A++ I SG  +RV+VIG++TFS+I+DW+DRST VLFGDGAGAL+LE  E  G+   D G
Sbjct: 123 NANALIVSGQAKRVLVIGAETFSKIMDWTDRSTSVLFGDGAGALLLEAQEGTGTP-EDRG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LST L SDG Y D LYVDGG ST  T G +RM+G  VF++AVEK         D   +T
Sbjct: 182 VLSTDLNSDGRYRDLLYVDGGVSTG-TTGYLRMQGNQVFRHAVEKLASTATTAMDRAGVT 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            ++IDW VPHQAN RII     K+ +  D+V+VTV  HGNTSAASIPLAL+V  + G++K
Sbjct: 241 ADDIDWVVPHQANIRIIQGTAKKLNLSMDQVVVTVQDHGNTSAASIPLALSVGQERGQIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD L+ EA+GGG   G V+LRW
Sbjct: 301 KGDLLVTEAIGGGLAWGAVVLRW 323


>gi|115360965|ref|YP_778102.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria AMMD]
 gi|115286293|gb|ABI91768.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           ambifaria AMMD]
          Length = 330

 Score =  328 bits (840), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 224/321 (69%), Gaps = 2/321 (0%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S V G G +LP R ++N D+  +VDT+D WI +R GI  R IA   E T+ L   AA  A
Sbjct: 12  SRVVGCGSALPERRVTNHDIARMVDTTDEWITQRTGIKERRIAADGEHTSDLAIGAATAA 71

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +S  D+DLI++AT TPD+T P+TAV +Q  +GM+ G AFD+QAVCSGFV+A++ A
Sbjct: 72  LKQAGISGADVDLIVLATCTPDRTMPATAVRVQEAIGMQGGVAFDVQAVCSGFVFALSVA 131

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D+ IR G  R  +VIG++T SRIVDW DR+TCVLFGDGAGA++L G    G      G+L
Sbjct: 132 DNMIRLGQARTAIVIGAETMSRIVDWQDRNTCVLFGDGAGAVVLRGERSDGDK--PRGVL 189

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L SDG + DK++ DGG S++++ G + +EG+ VF +AV    E  ++   +  LT +
Sbjct: 190 STHLHSDGRHHDKIHTDGGVSSTQSAGKMHLEGREVFLHAVVNLAEASQEALAAHGLTRD 249

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RI+ ++  K+ +P +KV++TV  HGNTSAASIPLAL+ AV +GR+K+ 
Sbjct: 250 DLDWVVPHQANQRIVQTLGMKLNLPMEKVVLTVGKHGNTSAASIPLALSEAVSDGRIKEN 309

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +L+ AMG GFT G  L+RW
Sbjct: 310 DLVLMPAMGSGFTWGAALIRW 330


>gi|170694827|ref|ZP_02885977.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           graminis C4D1M]
 gi|170140187|gb|EDT08365.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           graminis C4D1M]
          Length = 340

 Score =  328 bits (840), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 159/321 (49%), Positives = 224/321 (69%), Gaps = 2/321 (0%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S + G G +LP R +SN +L ++VDTS+ WI +R GI  R IA   E T+ L   AA  A
Sbjct: 22  SRIVGCGSALPERRMSNQELATMVDTSEEWITQRTGIKERRIAANGECTSDLAIRAAVSA 81

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A M   +ID++++AT TPD+T P+TAV +Q  LGM  G AFD+QAVCSGFV+A++ A
Sbjct: 82  LEQAGMRGSEIDVVVLATCTPDRTMPATAVRVQEALGMTGGVAFDVQAVCSGFVFALSVA 141

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D+ IR G  R  +VIG++T SRI+DW+DR++CVLFGDGAGA++L G    G S    GIL
Sbjct: 142 DNMIRLGQARNAVVIGAETMSRIIDWNDRNSCVLFGDGAGAVVLRGERHAGGSR--RGIL 199

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L SDG + DK++ DGG S+++T G + + G+ VF +AV    +  ++   +  L+ +
Sbjct: 200 STHLHSDGRHHDKIHTDGGTSSTQTAGKMHLAGREVFLHAVVNLSDASQEALAAHGLSND 259

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RI+ ++ +K+ +P +KV++TVD HGNTSAASIPLAL+ AV +GR+K+ 
Sbjct: 260 DLDWVVPHQANQRIVQTLAEKLHLPMEKVVLTVDHHGNTSAASIPLALSEAVADGRIKEN 319

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +L   MG GFT G  L+RW
Sbjct: 320 DLVLTPTMGSGFTWGAALIRW 340


>gi|296282449|ref|ZP_06860447.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Citromicrobium
           bathyomarinum JL354]
          Length = 314

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 169/313 (53%), Positives = 229/313 (73%), Gaps = 2/313 (0%)

Query: 13  LPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVD 72
           +P+RV++N +L   +DTSD WI  R GI +RHIAG+ ETT +L  AAAR AL  A +   
Sbjct: 1   MPQRVVTNEELAGRLDTSDEWIVERTGIRQRHIAGEGETTGTLAIAAARAALADAGIDAK 60

Query: 73  DIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVV 132
            IDLI++AT+TPD TFP+TA  +Q  LG     AFD+QAVCSGF+YA+TTAD+ +RSG  
Sbjct: 61  KIDLIVLATATPDNTFPATATKVQAALGCNGCPAFDVQAVCSGFLYAMTTADAMLRSGQA 120

Query: 133 RRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEV-KGSSMAD-TGILSTYLCSD 190
              +VIG++TFSRI+DW DR+T VLFGDGAGA++LE  +V +G++ ++  GIL++ L +D
Sbjct: 121 TCALVIGAETFSRILDWEDRTTAVLFGDGAGAIVLEAQDVAEGTAKSEGPGILTSQLHAD 180

Query: 191 GSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVP 250
           G+  D LYVDGGPST++TVG +RM+G+ VF++AV    +++  V     +T++ IDW VP
Sbjct: 181 GAQHDLLYVDGGPSTTQTVGHLRMKGREVFRHAVGNLAQVLGDVVAKAGITVDQIDWVVP 240

Query: 251 HQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEA 310
           HQAN RI+ +   K+ +P +KVIVTVD H NTSAAS+PLA A A  +GR+K GD +L EA
Sbjct: 241 HQANIRILEATAKKLGLPPEKVIVTVDQHANTSAASVPLAFAAARADGRIKPGDLVLFEA 300

Query: 311 MGGGFTSGTVLLR 323
           MGGGFT G  L+R
Sbjct: 301 MGGGFTWGASLVR 313


>gi|292493115|ref|YP_003528554.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus
           halophilus Nc4]
 gi|291581710|gb|ADE16167.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus
           halophilus Nc4]
          Length = 322

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 220/322 (68%), Gaps = 12/322 (3%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP R+L+N+DLE +V+TSD WI  R GI RRH+    +T   L E A R A+  A
Sbjct: 8   GTGGFLPERILTNADLERMVETSDQWITERTGIKRRHVVDPGQTACDLAELATRRAIEAA 67

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +S  +IDLI+VAT+TPD+ FPSTA  +Q RL +    AFD+QAVC+GFVYA+  A+ +I
Sbjct: 68  GISPQEIDLIVVATTTPDRVFPSTACLLQQRLDIHGCAAFDIQAVCTGFVYALGVAEKFI 127

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           R+G  R  +V+G++T SRIVDW+DR+TCVLFGDGAGA++L+       +  + GILST+L
Sbjct: 128 RTGSARTALVVGTETLSRIVDWTDRTTCVLFGDGAGAVVLQ-------ASPEPGILSTHL 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTV-----GCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
            +DGSY   L V  G S +  +       I+M+G  VFK AV     ++E+   +  +  
Sbjct: 181 HADGSYQQLLTVPAGISEAYELLKQGEAFIQMQGNEVFKMAVRTLERIVEETLAANSMDQ 240

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           + IDW +PHQAN RII +   K+ +P ++V+VTVD HGNTSAAS+PLAL +AV++GR+K+
Sbjct: 241 QEIDWLIPHQANIRIIAATAKKLNLPMERVVVTVDAHGNTSAASVPLALDIAVRDGRIKR 300

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           GD LLLEA GGGFT G+ LL +
Sbjct: 301 GDTLLLEAFGGGFTWGSALLMY 322


>gi|295689079|ref|YP_003592772.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caulobacter segnis
           ATCC 21756]
 gi|295430982|gb|ADG10154.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caulobacter segnis
           ATCC 21756]
          Length = 325

 Score =  327 bits (839), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 171/323 (52%), Positives = 224/323 (69%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G+G  LP +V++N DL   VDTSD WI  R GI +RH A  D+  + L   AA
Sbjct: 3   VVRSVVTGVGAYLPPKVVTNDDLAKFVDTSDEWIVERTGIRQRHQAADDQPVSDLAFEAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++AL  A  +  D+DLIIVAT+T D TFP+ A  +Q +LG   G AFD+QAVCSGFVYA+
Sbjct: 63  KEALAAAGKTAADVDLIIVATTTADLTFPAVATIVQRKLGAPVGIAFDVQAVCSGFVYAL 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++  G  +  +VIG++T +R++DWSDR TCVLFGDGAGA++LE  E +G++ AD 
Sbjct: 123 SVADGFVARGNAKCALVIGAETMTRLMDWSDRGTCVLFGDGAGAVVLEAGEGEGTT-ADR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L   L +DG+  D LYVDGGPST+ TVG +RM G  VFK+AV    E I    D   +
Sbjct: 182 GMLGFALRADGTKQDLLYVDGGPSTTGTVGKLRMLGNQVFKHAVVNISEAIHAAADKAGV 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            + N+DWF+PHQAN RI+  +  +  I  +KV+ TV IH NTSAASIPLALA A+ +GR+
Sbjct: 242 DVANVDWFIPHQANQRILQGVAHRCGIDENKVVSTVAIHANTSAASIPLALAHAINDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KKGD LLLEAMGGG T G  +LR
Sbjct: 302 KKGDLLLLEAMGGGLTWGACVLR 324


>gi|269958623|ref|YP_003328410.1| 3-oxoacyl-[acyl carrier protein] synthase 3 [Anaplasma centrale
           str. Israel]
 gi|269848452|gb|ACZ49096.1| 3-oxoacyl-[acyl carrier protein] synthase 3 [Anaplasma centrale
           str. Israel]
          Length = 322

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 221/323 (68%), Gaps = 2/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS   G+G  LP +V++N DL  +VDT+D W+ RR GI RRH+  +D+T + +   AA
Sbjct: 1   MRRSVFCGVGAFLPAKVITNDDLSLMVDTTDEWVFRRTGIKRRHVVEEDDTVSGMATEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +S  ++DL++VATSTPDQT PS A  +Q  LG K   AFD+ A CSGF+YA+
Sbjct: 61  KIALEDAGISAAEVDLVVVATSTPDQTMPSCATMVQGNLGCKNAAAFDVNAACSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           +  DS I++G     ++IGS+  S++VDW+DRSTCVLFGDGAGA +L+G +    S  DT
Sbjct: 121 SIVDSMIKAGQANIALIIGSEAMSKVVDWTDRSTCVLFGDGAGAFVLKGQDETFES--DT 178

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ST LCSDGS  D LY  GG  ++   GCIRM+G  +F++AV K    I  +     L
Sbjct: 179 GIMSTLLCSDGSLGDVLYTSGGVCSTGKAGCIRMKGTVLFEHAVVKLSSTIAALLARNAL 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            I ++DWFVPHQAN RII+ ++D++K+  DKVI+++D H NTS+ASIPLA+  A + G++
Sbjct: 239 DISSVDWFVPHQANVRIIDLVIDRLKLSRDKVILSIDEHANTSSASIPLAMYEAKRAGKI 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KKG+ +L  A+G G T G  L+R
Sbjct: 299 KKGNLILFAAIGAGLTWGVSLIR 321


>gi|91775860|ref|YP_545616.1| 3-oxoacyl-(acyl carrier protein) synthase III [Methylobacillus
           flagellatus KT]
 gi|91709847|gb|ABE49775.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Methylobacillus
           flagellatus KT]
          Length = 318

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 164/323 (50%), Positives = 223/323 (69%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP ++L+N+DLE +VDT+D WI  R GI +RHIA +++ T+ L   AA+
Sbjct: 3   IYSRILGTGSYLPEKILTNADLERMVDTTDEWIYARTGIRQRHIAAENQFTSDLAFHAAQ 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A + VD IDLIIVAT+TPD  FPSTA  +Q++LG +   AFD+QAVCSGF+YAV 
Sbjct: 63  RALEAAGVEVDAIDLIIVATTTPDHVFPSTACLLQHKLGNRGAPAFDVQAVCSGFIYAVA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TADS+IRSG  R  +V+G++T SRI DW+DRS C+L+GDGAGA+++   +         G
Sbjct: 123 TADSFIRSGAARTALVVGAETMSRITDWTDRSNCILWGDGAGAVVMGASD-------QPG 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L +DGSY   L V  G S       I MEG AVFK AV     ++++   +  + 
Sbjct: 176 IISTHLHADGSYTQLLNVPSGVSNPGAERTIHMEGNAVFKIAVNTLDAIVDETLAANGMQ 235

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW VPHQAN RI+ S   K+ +   +V+VTVD HGNTSAAS+PLAL VAV++GR+K
Sbjct: 236 KSDIDWLVPHQANIRILQSTARKLGMDMARVVVTVDKHGNTSAASVPLALDVAVRDGRIK 295

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
            G+ +L+EA GGGFT G++LL++
Sbjct: 296 HGETVLMEAFGGGFTWGSILLKF 318


>gi|253999097|ref|YP_003051160.1| 3-oxoacyl-(acyl carrier protein) synthase III [Methylovorus sp.
           SIP3-4]
 gi|253985776|gb|ACT50633.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylovorus sp.
           SIP3-4]
          Length = 317

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 165/324 (50%), Positives = 224/324 (69%), Gaps = 7/324 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP R+L+N++LE +VDTSD WI  R GI  RHIA + + T+ L   AA
Sbjct: 1   MTYSRIAGTGSYLPERILTNAELERMVDTSDEWIVTRTGIRERHIAAEGQFTSDLAYEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A ++ ++IDL+IVAT+TPD+ FPSTA  +Q RLG+    AFD+QAVCSGFVYA+
Sbjct: 61  LRAIEAAGITHEEIDLVIVATTTPDRVFPSTACLVQARLGLGPCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD++I+SG  +  +VIG++T SRI DW+DRS C+L+GDGAGA+IL   +       + 
Sbjct: 121 ATADNFIKSGAAKTALVIGAETMSRITDWTDRSNCILWGDGAGAVILRASD-------EM 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST+L +DG Y   L V  G S       I MEG AVFK AV     ++++  ++  L
Sbjct: 174 GILSTHLHADGQYARLLNVPTGVSQKEGSKTIHMEGNAVFKVAVNTLDAIVDETLEANGL 233

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RI+ S   K+ +  +KV+VTVD HGNTSAASIPLAL VAV++GR+
Sbjct: 234 QKSDVDWLVPHQANIRILQSTAKKLGMGMEKVVVTVDRHGNTSAASIPLALDVAVRDGRI 293

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+G+ LL+EA GGGFT G+VL+++
Sbjct: 294 KRGETLLMEAFGGGFTWGSVLVKF 317


>gi|297538526|ref|YP_003674295.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylotenera sp.
           301]
 gi|297257873|gb|ADI29718.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylotenera sp.
           301]
          Length = 316

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 227/326 (69%), Gaps = 12/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP+++L+N+DLES+VDT+D WI  R GI  RHI   DE T+ L   A+
Sbjct: 1   MTNSRIAGTGSYLPKKILTNADLESMVDTTDEWIFSRTGIRERHIVADDEFTSDLALHAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R+A+  A +   DIDLIIVAT+TPD+ FPSTAV +QN+LG+    AFD+QAVCSGFVYA+
Sbjct: 61  RNAIEAAGIQAGDIDLIIVATTTPDKIFPSTAVILQNKLGIAGCPAFDIQAVCSGFVYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD++I+SG  +  +VIG++ FSRIVDW++R  C+L+GDGAGA+IL+  E       + 
Sbjct: 121 ATADNFIKSGAAKCALVIGAEAFSRIVDWTNRGNCILWGDGAGAVILQASE-------EQ 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+ST+L +DG+Y   L+V   P +    G   + MEG  VFK AV     ++++  ++ 
Sbjct: 174 GIISTHLHADGNYEKMLHV---PRSEDPNGRDTVVMEGNGVFKVAVNTLDAIVDETLEAN 230

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +   +IDW VPHQAN RI+ +   K+ +  D V+VTVD HGNTSAASIPLAL  AV++G
Sbjct: 231 GMQKSDIDWLVPHQANIRILQATAKKLDMSMDNVVVTVDKHGNTSAASIPLALDTAVRDG 290

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+G+ +L+EA GGGFT G+ L+++
Sbjct: 291 RIKRGETILMEAFGGGFTWGSALIKY 316


>gi|190571413|ref|YP_001975771.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|254783839|sp|B3CML1|FABH_WOLPP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|190357685|emb|CAQ55133.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
          Length = 318

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 231/325 (71%), Gaps = 8/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M +S +   G  LP+++LSN+++  IV+T+D WI++R GI +RHIA + E T+ L   AA
Sbjct: 1   MSKSFILSTGSYLPKKILSNNEIALIVETNDEWIRQRTGIVQRHIADEGELTSDLAVNAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++A+  A++S+D+I LIIVAT+TPD+T PS A  +Q++L  K  F+FD+QA CSGF+YAV
Sbjct: 61  KNAIEKAKISIDEIGLIIVATTTPDKTLPSCATIVQSKLKCKNAFSFDVQAACSGFIYAV 120

Query: 121 TTADSYIRS-GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           T ADS I+S   ++  +VIG++  SRIVDW DRSTCVLFGD AGA+I++      S M  
Sbjct: 121 TVADSLIKSHNRIKYALVIGAEIMSRIVDWEDRSTCVLFGDSAGAVIIK------SEMGS 174

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           +GI+ST L SDG+ +D L  +GG S++R  G I M G+ VFK+AV+K    +E+     +
Sbjct: 175 SGIISTNLHSDGN-VDILCTNGGVSSTRDSGKILMNGREVFKHAVDKLTASVEETLKCNN 233

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L I +IDW +PHQAN RII ++V K+  P +KVI TVD H NTSAASIPLAL  A++E +
Sbjct: 234 LKIIDIDWLIPHQANIRIIEAVVKKLDFPIEKVINTVDKHANTSAASIPLALDYAIQESK 293

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +K G+ +LL ++G G T G+VLLR+
Sbjct: 294 IKSGNLVLLISIGAGLTWGSVLLRY 318


>gi|261856393|ref|YP_003263676.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halothiobacillus
           neapolitanus c2]
 gi|261836862|gb|ACX96629.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halothiobacillus
           neapolitanus c2]
          Length = 323

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 224/330 (67%), Gaps = 13/330 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI + + G G  LP R+L+N DLE +V+TSD WI+ R GI +RHIA K + T+ L E AA
Sbjct: 1   MIHARITGTGSYLPERILTNQDLEKMVETSDTWIRERTGIEQRHIAEKGQLTSDLAEPAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A     D+DL+IVAT+TPD+ FPSTA  +Q +LG+    AFD+QAVC+GFVYA+
Sbjct: 61  RRALEAAGKIPSDVDLLIVATTTPDRVFPSTACLLQQKLGIHGSPAFDIQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A+ +I++G  R  +VIG++T SRIV+W DR TCVLF DGAGA++LE  E       + 
Sbjct: 121 SVAEKFIKTGAARCALVIGAETLSRIVNWQDRGTCVLFADGAGAVVLEASE-------EP 173

Query: 181 GILSTYLCSDGSYIDKL-YVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKV 234
           GI+ST++ +DG+Y   L  V  GP       +     I M G  VFK AV     ++++ 
Sbjct: 174 GIISTHIHADGAYESLLTTVKPGPDVDLDKLADGTAFIEMRGNEVFKMAVNTLGRIVDET 233

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
            D+  ++  +IDW VPHQAN RII +   K+ +P ++V+VTV+ HGNTSAAS+PLAL  A
Sbjct: 234 LDAAGMSYADIDWLVPHQANIRIIQATARKLDLPMERVVVTVNKHGNTSAASVPLALDTA 293

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++GR+K+GD +LLEA GGGFT G+ L+++
Sbjct: 294 VRDGRIKRGDTILLEAFGGGFTWGSALIKF 323


>gi|254433614|ref|ZP_05047122.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus oceani
           AFC27]
 gi|207089947|gb|EDZ67218.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus oceani
           AFC27]
          Length = 322

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 226/327 (69%), Gaps = 12/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP RVL+N+DLE +VDTSD WI  R GI  RH+A  D+T   L E AA
Sbjct: 1   MSYARIIGTGGFLPERVLTNADLERLVDTSDRWIWERTGIKERHVAEPDQTACDLAELAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A ++  +IDLIIVAT+TPD+ FPSTA  +Q RL +    AFD+QAVC+GFVYA+
Sbjct: 61  WKAIEAAAIAPQEIDLIIVATTTPDRIFPSTACLLQQRLDIHDSAAFDIQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A+ +IR+G  R  +V+G++T SRI+DW+DR+TCVLFGDGAGA++L+       +  + 
Sbjct: 121 SVAEKFIRTGSARTALVVGTETLSRIIDWNDRTTCVLFGDGAGAVVLQ-------ASPEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTS-----RTVGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST+L +DGSY   L V  G S +     +    I+M+G  VFK AV     ++E+  
Sbjct: 174 GILSTHLHADGSYHQLLTVPAGISEAYERVKQGEAFIQMKGNEVFKIAVRTLERMVEETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
            + H++ + IDW +PHQAN RII +   K+ +P ++V+VTVD HGNTSAAS+PLAL +AV
Sbjct: 234 AANHMSQQEIDWLIPHQANIRIIAATAKKLNLPMERVVVTVDTHGNTSAASVPLALDIAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLL 322
           ++GR+K+GD LLLEA GGGFT G+ LL
Sbjct: 294 RDGRIKRGDTLLLEAFGGGFTWGSALL 320


>gi|77165144|ref|YP_343669.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrosococcus oceani
           ATCC 19707]
 gi|76883458|gb|ABA58139.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrosococcus oceani
           ATCC 19707]
          Length = 330

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/320 (51%), Positives = 223/320 (69%), Gaps = 12/320 (3%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP RVL+N+DLE +VDTSD WI  R GI  RH+A  D+T   L E AA  A+  A
Sbjct: 16  GTGGFLPERVLTNADLERLVDTSDRWIWERTGIKERHVAEPDQTACDLAELAAWKAIEAA 75

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            ++  +IDLIIVAT+TPD+ FPSTA  +Q RL +    AFD+QAVC+GFVYA++ A+ +I
Sbjct: 76  AIAPQEIDLIIVATTTPDRIFPSTACLLQQRLDIHDSAAFDIQAVCTGFVYALSVAEKFI 135

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           R+G  R  +V+G++T SRI+DW+DR+TCVLFGDGAGA++L+       +  + GILST+L
Sbjct: 136 RTGSARTALVVGTETLSRIIDWNDRTTCVLFGDGAGAVVLQ-------ASPEPGILSTHL 188

Query: 188 CSDGSYIDKLYVDGGPSTS-----RTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
            +DGSY   L V  G S +     +    I+M+G  VFK AV     ++E+   + H++ 
Sbjct: 189 HADGSYHQLLTVPAGISEAYERVKQGEAFIQMKGNEVFKIAVRTLERMVEETLAANHMSQ 248

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           + IDW +PHQAN RII +   K+ +P ++V+VTVD HGNTSAAS+PLAL +AV++GR+K+
Sbjct: 249 QEIDWLIPHQANIRIIAATAKKLNLPMERVVVTVDTHGNTSAASVPLALDIAVRDGRIKR 308

Query: 303 GDCLLLEAMGGGFTSGTVLL 322
           GD LLLEA GGGFT G+ LL
Sbjct: 309 GDTLLLEAFGGGFTWGSALL 328


>gi|53803724|ref|YP_114435.1| 3-oxoacyl-(acyl carrier protein) synthase III [Methylococcus
           capsulatus str. Bath]
 gi|81681656|sp|Q606L3|FABH_METCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|53757485|gb|AAU91776.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylococcus
           capsulatus str. Bath]
          Length = 321

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 221/327 (67%), Gaps = 16/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S + G G  LPR+V++N DL   V+TSD WI  R GI RRHIA  DET +S+ E A+R A
Sbjct: 5   SRIAGTGGYLPRQVVTNDDLAMRVETSDEWIVERTGIRRRHIAAADETASSMAEIASRQA 64

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +   D+DLII+ATS+PD+ FPSTA  +Q RLG++   AFD+QA CSGF++A++ A
Sbjct: 65  LEAAAIDPHDLDLIILATSSPDRVFPSTACLLQQRLGVRSCAAFDVQAACSGFIFALSIA 124

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D YI +G   RV+V+G++  SR VDW DRSTC+LFGDGAGA++LE       S  + GI+
Sbjct: 125 DQYISAGNANRVLVVGTEVNSRSVDWDDRSTCILFGDGAGAVVLE-------SATEPGIM 177

Query: 184 STYLCSDGSYIDKLYVDG------GPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ST++ SDG Y D LY+        G   SRT   IRM+G  VFK AV     ++++  + 
Sbjct: 178 STHIHSDGHYQDLLYLPNPASNGEGSDESRT---IRMQGSEVFKVAVNTLGRIVDETLEQ 234

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             L   ++DW VPHQAN RII +   K+++P ++V+VTVD  GNTS+ASIPLA   AV++
Sbjct: 235 NGLQKSDVDWLVPHQANIRIIAATAKKLQLPMERVVVTVDEQGNTSSASIPLAFDEAVRD 294

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+K+G  +L+EA GGGF  G+ LLR+
Sbjct: 295 GRIKRGQTVLMEAFGGGFAWGSALLRY 321


>gi|253996514|ref|YP_003048578.1| 3-oxoacyl-(acyl carrier protein) synthase III [Methylotenera
           mobilis JLW8]
 gi|253983193|gb|ACT48051.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylotenera
           mobilis JLW8]
          Length = 314

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 229/324 (70%), Gaps = 10/324 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI S + G G  LP ++L+N+DLE +VDT+D WI  R GI  RHIA + E T+ L   AA
Sbjct: 1   MIFSRIAGTGSYLPSKILTNADLERMVDTTDEWIFTRTGIRERHIAAEGEFTSDLALQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++A+  A +S +DIDLIIVAT+TPD+ FPS A  +Q +L +    AFD+QAVCSGFVYA+
Sbjct: 61  KNAIASAGLSPNDIDLIIVATATPDKVFPSVATMVQRKLEISGCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTAD++I++G  +  +VIG++TFSRI D++DR  C+L+GDGAGA++L+       + ++ 
Sbjct: 121 TTADNFIKAGSAKCALVIGAETFSRITDYTDRGNCILWGDGAGAVVLQ-------ASSEQ 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ST+L +DG Y + L+V   P  +     + MEG AVFK AV    +++++   + ++
Sbjct: 174 GIISTHLHADGRYENMLHV---PRNADKPDTVVMEGNAVFKVAVNTLDQIVDETLAANNM 230

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              +IDW VPHQAN RI+ +   K+ +  D+V+VTVD HGNTSAASIPLAL  AVK+GR+
Sbjct: 231 QKSDIDWLVPHQANIRILQATAKKLDMSMDRVVVTVDKHGNTSAASIPLALDTAVKDGRI 290

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+GD +L+EA GGGFT G+ L+++
Sbjct: 291 KRGDMILMEAFGGGFTWGSALIKY 314


>gi|313201199|ref|YP_004039857.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylovorus sp.
           MP688]
 gi|312440515|gb|ADQ84621.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylovorus sp.
           MP688]
          Length = 317

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 164/324 (50%), Positives = 223/324 (68%), Gaps = 7/324 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP R+L+N++LE +VDTSD WI  R GI  RHIA + + T+ L   AA
Sbjct: 1   MTYSRIAGTGSYLPERILTNAELERMVDTSDEWIVTRTGIRERHIAAEGQFTSDLAYEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A ++ ++IDL+IVAT+TPD+ FPSTA  +Q RL +    AFD+QAVCSGFVYA+
Sbjct: 61  LRAIEAAGITHEEIDLVIVATTTPDRVFPSTACLVQARLELGPCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD++I+SG  +  +VIG++T SRI DW+DRS C+L+GDGAGA+IL   +       + 
Sbjct: 121 ATADNFIKSGAAKTALVIGAETMSRITDWTDRSNCILWGDGAGAVILRASD-------EM 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST+L +DG Y   L V  G S       I MEG AVFK AV     ++++  ++  L
Sbjct: 174 GILSTHLHADGQYARLLNVPTGVSQKEGSKTIHMEGNAVFKVAVNTLDAIVDETLEANGL 233

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RI+ S   K+ +  +KV+VTVD HGNTSAASIPLAL VAV++GR+
Sbjct: 234 QKSDVDWLVPHQANIRILQSTAKKLGMGMEKVVVTVDRHGNTSAASIPLALDVAVRDGRI 293

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K+G+ LL+EA GGGFT G+VL+++
Sbjct: 294 KRGETLLMEAFGGGFTWGSVLVKF 317


>gi|213018811|ref|ZP_03334619.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|212995762|gb|EEB56402.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 312

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/316 (50%), Positives = 227/316 (71%), Gaps = 8/316 (2%)

Query: 10  GLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEM 69
           G  LP+++LSN+++  IV+T+D WI++R GI +RHIA + E T+ L   AA++A+  A++
Sbjct: 4   GSYLPKKILSNNEIALIVETNDEWIRQRTGIVQRHIADEGELTSDLAVNAAKNAIEKAKI 63

Query: 70  SVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRS 129
           S+D+I LIIVAT+TPD+T PS A  +Q++L  K  F+FD+QA CSGF+YAVT ADS I+S
Sbjct: 64  SIDEIGLIIVATTTPDKTLPSCATIVQSKLKCKNAFSFDVQAACSGFIYAVTVADSLIKS 123

Query: 130 -GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLC 188
              ++  +VIG++  SRIVDW DRSTCVLFGD AGA+I++      S M  +GI+ST L 
Sbjct: 124 HNRIKYALVIGAEIMSRIVDWEDRSTCVLFGDSAGAVIIK------SEMGSSGIISTNLH 177

Query: 189 SDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWF 248
           SDG+ +D L  +GG S++R  G I M G+ VFK+AV+K    +E+     +L I +IDW 
Sbjct: 178 SDGN-VDILCTNGGVSSTRDSGKILMNGREVFKHAVDKLTASVEETLKCNNLKIIDIDWL 236

Query: 249 VPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLL 308
           +PHQAN RII ++V K+  P +KVI TVD H NTSAASIPLAL  A++E ++K G+ +LL
Sbjct: 237 IPHQANIRIIEAVVKKLDFPIEKVINTVDKHANTSAASIPLALDYAIQESKIKSGNLVLL 296

Query: 309 EAMGGGFTSGTVLLRW 324
            ++G G T G+VLLR+
Sbjct: 297 ISIGAGLTWGSVLLRY 312


>gi|115360973|ref|YP_778110.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria AMMD]
 gi|115286301|gb|ABI91776.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           ambifaria AMMD]
          Length = 345

 Score =  322 bits (824), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 226/323 (69%), Gaps = 1/323 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
            RS V G G +LP R ++N +L   VDTSD WI RR GI  R IA   E T+    AAAR
Sbjct: 24  FRSCVIGCGSALPERRVTNDELARTVDTSDEWIVRRSGIRERRIAAAHEKTSDFAIAAAR 83

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A+++  D+DL+IVAT+T DQT PSTA  +Q  +GM +G AFD+ A CSGFVYA++
Sbjct: 84  RALERADLTGADLDLLIVATTTADQTVPSTAARVQAAIGMHQGAAFDVNAACSGFVYALS 143

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            ADS +R G V   +VIG++T SRIVDW++R +CVLFGDGAGA+IL      GS+    G
Sbjct: 144 VADSMMRLGQVGTALVIGAETLSRIVDWTERESCVLFGDGAGAVILRAEPSDGSTN-QRG 202

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +LST+L SDG + DK+  DGG S++ TVG +R+EG+ VF +AV     + ++   +T L+
Sbjct: 203 VLSTHLHSDGRHQDKIRTDGGVSSTGTVGKVRLEGREVFLHAVMNLTAVADEALAATGLS 262

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++DW VPHQAN RI+ ++  ++ IP +K ++TVD H NTSAASIPLAL  AV +GRVK
Sbjct: 263 RDDVDWLVPHQANQRIVETVGQQLHIPAEKTVLTVDRHANTSAASIPLALDAAVTDGRVK 322

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD +LL +MGGGFT G+ LLRW
Sbjct: 323 EGDLVLLASMGGGFTWGSALLRW 345


>gi|241759456|ref|ZP_04757560.1| 3-oxoacyl-[acyl carrier protein] synthase III [Neisseria flavescens
           SK114]
 gi|241320238|gb|EER56571.1| 3-oxoacyl-[acyl carrier protein] synthase III [Neisseria flavescens
           SK114]
          Length = 320

 Score =  321 bits (823), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 222/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA   E T+ L   +A
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADDSEKTSDLAAESA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A++  DDIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADADLQADDIDLIIVATATPDMQFPSTATIVQQKLGIANGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+  +
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y++ L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLNLLNVPGQIANGQICGSPYISMDGPGVFKFAVKMLAKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + IDW VPHQAN RII+S    + +  DKVI+TV  HGNTSAASIPLAL V +K 
Sbjct: 234 AGYTTDQIDWLVPHQANKRIIDSTAKHLGLSMDKVILTVQDHGNTSAASIPLALDVGIKN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLVKY 320


>gi|298369566|ref|ZP_06980883.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria sp. oral
           taxon 014 str. F0314]
 gi|298282123|gb|EFI23611.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria sp. oral
           taxon 014 str. F0314]
          Length = 320

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 224/327 (68%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   +A
Sbjct: 1   MQYAKILGTGSYLPANRISNDDLAQKVDTSDEWITTRTGIKFRHIADENEKTSDLAAESA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +S D+IDLIIVAT+TPD  FPSTA  +Q++LGM  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALAAAGISADEIDLIIVATATPDMQFPSTATIVQHKLGMTNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           + TAD+Y++SG+ ++V+VIG++TFSRI+DWSDR+TCVLFGDGAGA++L   +       +
Sbjct: 121 LNTADAYVKSGMAKKVLVIGAETFSRILDWSDRTTCVLFGDGAGAVVLGAAD-------E 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y+D L V G  +  +  G   I+M+G  VFK+AV+   ++ E+V   
Sbjct: 174 PGIIHGKLQADGNYLDLLNVPGQIANGQICGTPYIKMDGPGVFKFAVKMLAKVAEEVIRE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +T + +DW VPHQAN RII S    + +  +KVI+TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGMTPDQVDWLVPHQANKRIIESTAKHLGLGMEKVILTVQDHGNTSAASIPLALDAGIQS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++++G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIQRGHNLLLEGIGGGFAWGAVLLKY 320


>gi|319639371|ref|ZP_07994122.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria mucosa C102]
 gi|317399555|gb|EFV80225.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria mucosa C102]
          Length = 320

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 222/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA + E T+ L   +A
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADEGEKTSDLAAESA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +  DDIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAHLQADDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+  +
Sbjct: 121 MTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y++ L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLNLLNVPGQIANGQVCGSPYISMDGPGVFKFAVKMLAKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + IDW VPHQAN RII+S    + +  DKVI+TV  HGNTSAASIPLAL V +K 
Sbjct: 234 AGYTADQIDWIVPHQANKRIIDSTAKHLGLSMDKVILTVQDHGNTSAASIPLALDVGIKN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLVKY 320


>gi|300114117|ref|YP_003760692.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus
           watsonii C-113]
 gi|299540054|gb|ADJ28371.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitrosococcus
           watsonii C-113]
          Length = 322

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 227/327 (69%), Gaps = 12/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP+RVL+N+DLE +VDTSD WI+ R GI  RH+A  D+T   L E AA
Sbjct: 1   MSYTRIIGTGGFLPKRVLTNADLERLVDTSDQWIRERTGIKERHVAEPDQTACDLAELAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A ++  +IDLIIVAT+TPD+ FPSTA  +Q RL +    AFD+QAVC+GFVYA+
Sbjct: 61  WKAIEAAAIAPQEIDLIIVATTTPDRIFPSTACLLQQRLDIHDSAAFDIQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A+ +IR+G  +  +V+G++T SRI+DWSDRSTCVLFGDGAGA++L+       + ++ 
Sbjct: 121 SIAEKFIRTGSAQTALVVGTETLSRIIDWSDRSTCVLFGDGAGAVVLQ-------ASSEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTS-----RTVGCIRMEGKAVFKYAVEKAVELIEKVF 235
           G+LST+L +DGSY + L V  G S +     +    I+M+G  VFK AV     ++E+  
Sbjct: 174 GVLSTHLHADGSYQELLTVPAGISEAYERVKQGEAFIQMKGNEVFKIAVRTLEYMVEETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
            +  +T + IDW +PHQAN RII +   K+ +  ++VIVTVD HGNTSAAS+PLAL + V
Sbjct: 234 AANGMTQQEIDWLIPHQANIRIIAATAKKLNLSMERVIVTVDTHGNTSAASVPLALDIGV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLL 322
           ++GR+K+GD LLLEA GGGFT G+ LL
Sbjct: 294 RDGRIKRGDTLLLEAFGGGFTWGSALL 320


>gi|114330490|ref|YP_746712.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrosomonas
           eutropha C91]
 gi|122314499|sp|Q0AIS4|FABH_NITEC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|114307504|gb|ABI58747.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrosomonas
           eutropha C91]
          Length = 320

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 220/325 (67%), Gaps = 9/325 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP ++L+N +LES+VDTSD WI+ R GI +RHIA   +  + L   A+R
Sbjct: 3   MYSRIIGTGSYLPEKILTNLELESMVDTSDEWIQARTGIKQRHIAAPGQMASDLALEASR 62

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +   DIDL+IVAT+TPD  FPSTA  +QN+LG+    AFD+QAVCSGF+YA+ 
Sbjct: 63  NAIEAAGIQASDIDLVIVATTTPDMIFPSTACILQNKLGISGSPAFDVQAVCSGFIYALA 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD ++ SG  R  +++GS+ +SRI+DW+DRSTCVLFGDGAGA++L       +     G
Sbjct: 123 TADMFVSSGKSRNALIVGSEVYSRIMDWNDRSTCVLFGDGAGAVVL-------TRDQKPG 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILS++L +DGSY   L       + +  G   I MEG  VFK+AV+   E + +   +  
Sbjct: 176 ILSSHLHADGSYSQVLSAPASIHSGKIQGTPFITMEGSTVFKFAVKVLEEAVLEALHAND 235

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L   +IDW +PHQAN RII S   K+ IP +KV+VTV  HGNTSAAS+PLAL  AV++GR
Sbjct: 236 LQSSDIDWLIPHQANIRIITSTAKKLGIPEEKVVVTVTQHGNTSAASVPLALDQAVRDGR 295

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           V+ G  ++LE +GGGFT G+VL+RW
Sbjct: 296 VQSGQHVVLEGVGGGFTWGSVLVRW 320


>gi|58697191|ref|ZP_00372602.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225630649|ref|YP_002727440.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia sp. wRi]
 gi|58536490|gb|EAL59878.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia
           endosymbiont of Drosophila simulans]
 gi|225592630|gb|ACN95649.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Wolbachia sp. wRi]
          Length = 302

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 223/309 (72%), Gaps = 8/309 (2%)

Query: 17  VLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDL 76
           +LSN+++ SIV+TSD WI++R GI +RHIA + E T+ L   AA+ A+  A++SVD+IDL
Sbjct: 1   MLSNNEIASIVETSDEWIRQRTGIVQRHIADEGELTSDLAVNAAKSAIEKAKISVDEIDL 60

Query: 77  IIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGV-VRRV 135
           IIVAT+TPD+TFPS A  +Q++L  K  FAFD+QA CSGF+YAVT ADS I+S   ++  
Sbjct: 61  IIVATTTPDKTFPSCATIVQSKLKCKNAFAFDVQAACSGFIYAVTVADSLIKSNNRIKYA 120

Query: 136 MVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYID 195
           +VIG++  SRIVDW DRSTCVLFGDGAGA++++      S M  +GI+ST L SDG+ +D
Sbjct: 121 LVIGAEIMSRIVDWEDRSTCVLFGDGAGAVVMK------SEMGRSGIISTNLYSDGN-VD 173

Query: 196 KLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANW 255
            L  +GG S++   G I M G+ VFK+AV+K    +E+     +L I +IDW +PHQAN 
Sbjct: 174 ILCTNGGISSTGDSGKICMNGREVFKHAVDKLTASVEETLKCNNLKITDIDWLIPHQANI 233

Query: 256 RIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGF 315
           RII ++V K+  P +KVI TVD H NTSAASIPLAL  A++E ++K G+ +LL ++G G 
Sbjct: 234 RIIEAVVKKLDFPIEKVINTVDKHANTSAASIPLALDYAIQESKIKSGNLVLLISIGAGL 293

Query: 316 TSGTVLLRW 324
           T G+VLL +
Sbjct: 294 TWGSVLLHY 302


>gi|117924943|ref|YP_865560.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Magnetococcus sp.
           MC-1]
 gi|117608699|gb|ABK44154.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Magnetococcus sp.
           MC-1]
          Length = 346

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 229/348 (65%), Gaps = 30/348 (8%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS + G G  LP R L+N +L ++V+T+  WI+ R GI  R IA   E T+ L   AA 
Sbjct: 4   LRSRIIGTGSYLPERRLTNDELAAMVETTSSWIEERTGIQERRIAAPGEMTSDLAVKAAE 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM--KRGFAFDMQAVCSGFVYA 119
            AL  A ++  ++DLI+VAT+TPD  FPSTA  +Q RLG    R  AFD+QAVC+GF+YA
Sbjct: 64  QALQAAGIAAWELDLILVATTTPDLIFPSTATIVQKRLGADKTRIPAFDIQAVCTGFIYA 123

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTAD +IR+G  +RV+VIG++TFSRI++W DR TC+LFGDGAGA++LE  E       D
Sbjct: 124 LTTADQFIRAGSAKRVLVIGAETFSRIINWQDRGTCILFGDGAGAVVLEAHEA-----VD 178

Query: 180 TGILSTYLCSDGSYIDKLY-----------VDGGPSTSRTV------------GCIRMEG 216
            GILST++ +DGSY+D L            V GG +  ++             G + M G
Sbjct: 179 QGILSTHIYADGSYLDLLRCTTGVSDGGSRVPGGDAQPQSTDARGVQAMLEGFGYVTMRG 238

Query: 217 KAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTV 276
             VFK AV    +++++  ++ +L+  ++DW VPHQAN RIINS   ++ +  D+V+VTV
Sbjct: 239 NEVFKRAVMALEQIVDETLEANNLSKSDVDWLVPHQANIRIINSTAKRLGMSMDQVVVTV 298

Query: 277 DIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + HGNTSAAS+PLAL  AV++GR+K G  +L+EA GGGFT G+VL+RW
Sbjct: 299 ERHGNTSAASVPLALDEAVRDGRIKPGQLVLMEAFGGGFTWGSVLVRW 346


>gi|289208768|ref|YP_003460834.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thioalkalivibrio sp.
           K90mix]
 gi|288944399|gb|ADC72098.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thioalkalivibrio sp.
           K90mix]
          Length = 320

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/326 (49%), Positives = 222/326 (68%), Gaps = 10/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP R+L+N+DLE++VDTSD WI+ R GI  RHI  +++ T+ L   AA
Sbjct: 1   MKHARISGTGSYLPERILTNADLEAMVDTSDAWIQERTGIRERHIVAENQVTSDLALKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +   D+DLIIVAT+TPDQ FPSTA  +Q +LG+    AFD+QAVCSGFVYA+
Sbjct: 61  ERALDAAGIRPADLDLIIVATTTPDQIFPSTACILQAKLGIGGCPAFDVQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD +++S  +R V+V+G++T SRI D++DR  C+L+GDGAGA++L       S   D 
Sbjct: 121 ATADRFMQSDEIRHVLVVGAETLSRITDYTDRGNCILWGDGAGAVVL-------SRSPDP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG---PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           GI+ST+L +DG +   L V GG   P  +  +  IRMEG+AVF+ AV    +++++  + 
Sbjct: 174 GIISTHLHADGHHKGLLEVPGGVSQPGDNPDLEFIRMEGRAVFRVAVNTLDQIVDETLEY 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +    +DW VPHQAN RII +   K+ +  D V+VTVD HGNTSAASIPLAL  AV++
Sbjct: 234 NGIDKSELDWLVPHQANIRIIQATAKKLNMSMDNVVVTVDRHGNTSAASIPLALDTAVRD 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLR 323
           GR+KKGD +L EA GGGFT G+ L+R
Sbjct: 294 GRIKKGDLILTEAFGGGFTWGSALIR 319


>gi|120554298|ref|YP_958649.1| 3-oxoacyl-(acyl carrier protein) synthase III [Marinobacter
           aquaeolei VT8]
 gi|166233379|sp|A1U0E3|FABH_MARAV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120324147|gb|ABM18462.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Marinobacter
           aquaeolei VT8]
          Length = 322

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 222/329 (67%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP  +++N DLE  V+TSD WI+ R GI +RHIA   ++T  L E AA
Sbjct: 1   MTFARIAGTGSYLPDNIVTNRDLEQKVETSDQWIRERTGIEQRHIALPGQSTVDLAEQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
            +A+  A +   DIDLI+ AT+TPD+ FPS A  +Q RLG++   AFD+QAVCSGFVYA+
Sbjct: 61  LNAIEAAGIEATDIDLIVFATTTPDKVFPSCACILQARLGIQGCPAFDIQAVCSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+ +IR+G  ++ +VIG++ FSRI++W DR+TCVLFGDGAGA++LE  E       +T
Sbjct: 121 ATAEKFIRTGSSKKALVIGAEVFSRILNWEDRTTCVLFGDGAGAVVLEASE-------ET 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG-----PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GILST+L +DG Y + L+V  G      +       + M+G  VFK AV     ++++  
Sbjct: 174 GILSTHLHADGRYEELLHVPCGIANDFDAVKAGQAFVEMKGNEVFKVAVNTLGRIVDETL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           ++  +    IDW VPHQAN RII +   K+ +P D+V+VTV+ HGNTSAASIPLAL  AV
Sbjct: 234 EANQMQKSEIDWLVPHQANLRIIAATARKLDMPMDQVVVTVNRHGNTSAASIPLALDEAV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR+++G  +LLEA GGGFT G+ LLR+
Sbjct: 294 RDGRIQRGQVVLLEAFGGGFTWGSALLRY 322


>gi|225077265|ref|ZP_03720464.1| hypothetical protein NEIFLAOT_02320 [Neisseria flavescens
           NRL30031/H210]
 gi|224951409|gb|EEG32618.1| hypothetical protein NEIFLAOT_02320 [Neisseria flavescens
           NRL30031/H210]
          Length = 320

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 221/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA  +E T+ L   +A
Sbjct: 1   MQYAKIFGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADDNEKTSDLAAESA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +  DDIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADANLQADDIDLIIVATATPDMQFPSTATIVQQKLGIANGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+  +
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y++ L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHGKLKADGNYLNLLNVPGQIANGQVCGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + IDW VPHQAN RII+S    + +  DKVI+TV  HGNTSAASIPLAL V +K 
Sbjct: 234 AGYTADQIDWIVPHQANKRIIDSTAKHLGLSMDKVILTVQDHGNTSAASIPLALDVGIKN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLVKY 320


>gi|71275375|ref|ZP_00651661.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Dixon]
 gi|71898547|ref|ZP_00680718.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Ann-1]
 gi|170730352|ref|YP_001775785.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xylella fastidiosa
           M12]
 gi|71163675|gb|EAO13391.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Dixon]
 gi|71731671|gb|EAO33731.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Ann-1]
 gi|167965145|gb|ACA12155.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Xylella fastidiosa M12]
          Length = 324

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 220/327 (67%), Gaps = 11/327 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I + + G G  LP +VL+N DL  IVDTSD WI+ R GI  RHIA + ETT+ L   AA 
Sbjct: 5   IYARIAGTGGYLPEKVLTNDDLAHIVDTSDEWIRTRTGIRERHIAAEGETTSDLAYEAAI 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  AE+   D+DLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  RALEAAEVRSADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+ ++ SG  + V+V+G+DT +RI+DWSDR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VAEKFVSSGCSKTVLVVGADTLTRIIDWSDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLY----VDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST+L +DGS  + L+    V  G    +  G + M+G  VFKYAV+    ++++  ++
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKDCGALLMKGNEVFKYAVKALDRVVDETLEA 237

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            HL    +DW +PHQAN RII +   ++ +  D+V+VTVD HGNTS AS+PLAL  A++ 
Sbjct: 238 NHLDKHELDWLIPHQANLRIIEATARRLDMSMDQVVVTVDRHGNTSTASVPLALDEAIRS 297

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 GRVQRGQLLLLEAFGGGFTWGSALLRY 324


>gi|15838415|ref|NP_299103.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xylella fastidiosa
           9a5c]
 gi|34098742|sp|Q9PCG4|FABH_XYLFA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|9106896|gb|AAF84623.1|AE004003_2 beta-ketoacyl-[ACP] synthase III [Xylella fastidiosa 9a5c]
          Length = 324

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 220/327 (67%), Gaps = 11/327 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I + + G G  LP +VL+N DL  IVDTSD WI+ R GI  RHIA + ETT+ L   AA 
Sbjct: 5   IYARIAGTGGYLPEKVLTNDDLAHIVDTSDEWIRTRTGIRERHIAAEGETTSDLAYEAAI 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  AE+   D+DLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  CALEAAEVRSADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+ ++ SG  + V+V+G+DT +RI+DWSDR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VAEKFVSSGCSKTVLVVGADTLTRIIDWSDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLY----VDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST+L +DGS  + L+    V  G    +  G + M+G  VFKYAV+    ++++  ++
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKDCGALLMKGNEVFKYAVKALDRVVDETLEA 237

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            HL    +DW +PHQAN RII +   ++ +  D+V+VTVD HGNTS AS+PLAL  A++ 
Sbjct: 238 NHLDKHELDWLIPHQANLRIIEATARRLDMSMDQVVVTVDRHGNTSTASVPLALDEAIRS 297

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 GRVQRGQLLLLEAFGGGFTWGSALLRY 324


>gi|71900529|ref|ZP_00682658.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Ann-1]
 gi|71729705|gb|EAO31807.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH) [Xylella
           fastidiosa Ann-1]
          Length = 324

 Score =  318 bits (815), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 220/327 (67%), Gaps = 11/327 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I + + G G  LP +VL+N DL  IVDTSD WI+ R GI  RHIA + ETT+ L   AA 
Sbjct: 5   IYARIAGTGGYLPEKVLTNDDLAHIVDTSDEWIRTRTGIRERHIAAEGETTSDLAYEAAI 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  AE+   D+DLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGF+YA++
Sbjct: 65  RALEAAEVRSADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFIYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+ ++ SG  + V+V+G+DT +RI+DWSDR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VAEKFVSSGCSKTVLVVGADTLTRIIDWSDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLY----VDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST+L +DGS  + L+    V  G    +  G + M+G  VFKYAV+    ++++  ++
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKDCGALLMKGNEVFKYAVKALDRVVDETLEA 237

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            HL    +DW +PHQAN RII +   ++ +  D+V+VTVD HGNTS AS+PLAL  A++ 
Sbjct: 238 NHLDKHELDWLIPHQANLRIIEATARRLDMSMDQVVVTVDRHGNTSTASVPLALDEAIRS 297

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 GRVQRGQLLLLEAFGGGFTWGSALLRY 324


>gi|126739444|ref|ZP_01755137.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           SK209-2-6]
 gi|126719544|gb|EBA16253.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Roseobacter sp.
           SK209-2-6]
          Length = 306

 Score =  318 bits (814), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 168/308 (54%), Positives = 218/308 (70%), Gaps = 2/308 (0%)

Query: 17  VLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDL 76
           ++ N++ E  +DT+D WI+ R GI RRH A + ETT+ +  AAA+ AL  A M  + +D 
Sbjct: 1   MVENAEFEKTLDTTDEWIRSRSGIERRHFAAEGETTSDMAAAAAKAALAEAGMEAESVDA 60

Query: 77  IIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVM 136
           I++ATST D TFPS A  +Q++LGM RGFAFD+QAVC+GF YA+  A++ I SG   RV+
Sbjct: 61  IVLATSTADLTFPSAATMVQSKLGMTRGFAFDVQAVCAGFAYALANANALILSGQADRVL 120

Query: 137 VIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDK 196
           VIG++TFSRI+DW+DRSTCVLFGDGAGAL+LE  E  G+S  D GIL+T L SDG Y D 
Sbjct: 121 VIGAETFSRIMDWTDRSTCVLFGDGAGALLLEAQESAGTS-DDRGILATDLNSDGRYKDL 179

Query: 197 LYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWR 256
           LYVDGG ST  T G +RM+G  VF++AVEK  +      +  +LT  ++DW VPHQAN R
Sbjct: 180 LYVDGGVSTQNT-GHLRMQGNQVFRHAVEKLAKTANTALERANLTTADVDWIVPHQANIR 238

Query: 257 IINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFT 316
           II     KM +  D V+VTV  HGNTSAASIPLAL+V    G++K+GD ++ EA+GGG  
Sbjct: 239 IIQGTAKKMGLSMDNVVVTVQDHGNTSAASIPLALSVGKSRGQIKEGDLIVTEAIGGGLA 298

Query: 317 SGTVLLRW 324
            G V+LRW
Sbjct: 299 WGAVVLRW 306


>gi|302878771|ref|YP_003847335.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Gallionella
           capsiferriformans ES-2]
 gi|302581560|gb|ADL55571.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Gallionella
           capsiferriformans ES-2]
          Length = 319

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 170/326 (52%), Positives = 219/326 (67%), Gaps = 10/326 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP + LSN DLE  VDT+D WI  R GI  RHIA  DE T+ L   A+ 
Sbjct: 1   MHAKIIGTGSYLPVKTLSNFDLEKFVDTTDEWIVSRSGIHERHIAADDEVTSDLALHASL 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSGFVYAV 120
            A+  A +   DIDLIIVAT+ PD+ FPSTA  +Q++LG+K G  AFDMQAVC GFVYA+
Sbjct: 61  RAIEMAGIEASDIDLIIVATTCPDKIFPSTACILQDKLGIKNGGAAFDMQAVCGGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD YIR G  + V+V+G++  SRI+DW DR+TCVLFGDGAGA+IL+       + ++ 
Sbjct: 121 NTADLYIRGGQAKTVLVVGAEIMSRILDWKDRTTCVLFGDGAGAVILQ-------ASSEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL++ L SDG +   L VDG  S     G   IRMEG+AVFK+AV     ++++V    
Sbjct: 174 GILASRLHSDGQHHALLRVDGTVSDGVVQGDPFIRMEGQAVFKFAVTVLSRVVDEVLTIA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW VPHQAN RII +   K+ +  D V+VTV  HGNTS+ASIPLAL  AV++G
Sbjct: 234 GLKGSDIDWLVPHQANIRIIEATAKKLGLSLDNVVVTVANHGNTSSASIPLALDAAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K G  +LLEA+GGGFT G VLL+W
Sbjct: 294 RIKAGQHVLLEAIGGGFTWGAVLLKW 319


>gi|82702201|ref|YP_411767.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nitrosospira
           multiformis ATCC 25196]
 gi|123544744|sp|Q2YA46|FABH_NITMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|82410266|gb|ABB74375.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nitrosospira
           multiformis ATCC 25196]
          Length = 319

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 218/326 (66%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + V G G  LP ++L+N DLE +VDTSD WI+ R GI++RHIA   E  + L   A+
Sbjct: 1   MKYARVIGTGSYLPEKILTNHDLERMVDTSDEWIRTRTGIAQRHIAADSEMASDLALNAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R+A+    +   +I+L+IVAT+TPD  FPSTA  +Q++LG+    AFD+QAVCSGF+YA+
Sbjct: 61  REAIKAGGIDAREIELVIVATTTPDMIFPSTACILQDKLGIGDCAAFDVQAVCSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD +IR+G  +  +V+G++ +SRI+DWSDRSTCVLFGDGAGA++L G E         
Sbjct: 121 ATADMFIRAGKCQTALVVGAEVYSRILDWSDRSTCVLFGDGAGAVLLTGDE-------RP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           G+LST+L +DGS    L         +  G   + MEG  VFK+AV+   E++ +     
Sbjct: 174 GVLSTHLHADGSQSKILSAPANICGGKVQGKPFVVMEGNTVFKFAVKVLEEVVHEALTEN 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           +L   +IDW +PHQAN RII S   K+ IP DKV+ TVD HGNTSAASIPLAL +A ++G
Sbjct: 234 NLESSDIDWLIPHQANIRIIASTAKKLGIPMDKVVATVDKHGNTSAASIPLALDIAARDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K G  +LLE +GGGFT G  L+RW
Sbjct: 294 RIKSGQHVLLEGVGGGFTWGAALIRW 319


>gi|28198945|ref|NP_779259.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xylella fastidiosa
           Temecula1]
 gi|182681654|ref|YP_001829814.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xylella fastidiosa
           M23]
 gi|34098469|sp|Q87CL7|FABH_XYLFT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|28057043|gb|AAO28908.1| 3-oxoacyl-[ACP] synthase III [Xylella fastidiosa Temecula1]
 gi|182631764|gb|ACB92540.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xylella fastidiosa
           M23]
 gi|307580089|gb|ADN64058.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 324

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 221/327 (67%), Gaps = 11/327 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I + + G G  LP +VL+N+DL  IVDTSD WI+ R GI  RHIA + ETT+ L   AA 
Sbjct: 5   IFARIAGTGGYLPEKVLTNNDLAHIVDTSDEWIRTRTGIRERHIAAEGETTSDLAYEAAI 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  AE+   D+DLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  RALEAAEVRSADLDLIVVGTTTPDLIFPSTACLLQARLGAVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+ ++ SG  + V+V+G+DT +RI+DWSDR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VAEKFVSSGCSKTVLVVGADTLTRIIDWSDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLY----VDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST+L +DGS  + L+    V  G    +  G + M+G  VFKYAV+    ++++  ++
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKDCGALLMKGNEVFKYAVKALDRVVDETLEA 237

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            HL    +DW +PHQAN RII +   ++ +  ++V+VTVD HGNTS AS+PLAL  A++ 
Sbjct: 238 NHLDKHELDWLIPHQANLRIIEATARRLDMSMNQVVVTVDRHGNTSTASVPLALDEAIRS 297

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 GRVQRGQLLLLEAFGGGFTWGSALLRY 324


>gi|284799982|ref|ZP_05985366.2| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria subflava
           NJ9703]
 gi|284796260|gb|EFC51607.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria subflava
           NJ9703]
          Length = 343

 Score =  316 bits (809), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 220/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA   E T+ L   +A
Sbjct: 24  MQYAKISGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADDSEKTSDLAAESA 83

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
             AL  A++  DDIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 84  CRALADADLQADDIDLIIVATATPDMQFPSTATIVQQKLGIANGCPAFDVQAVCAGFMYA 143

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+  +
Sbjct: 144 MTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDE 196

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y++ L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 197 PGIIHGKLKADGNYLNLLNVPGQIANGQICGSPYISMDGPGVFKFAVKMLSKIADDVIEE 256

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + IDW VPHQAN RII+S    + +  DKVI+TV  HGNTSAASIPLAL V +K 
Sbjct: 257 AGYTTDQIDWLVPHQANKRIIDSTAKHLGLSMDKVILTVQDHGNTSAASIPLALDVGIKN 316

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 317 GQIKRGQNLLLEGIGGGFAWGAVLVKY 343


>gi|294670547|ref|ZP_06735426.1| hypothetical protein NEIELOOT_02269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307672|gb|EFE48915.1| hypothetical protein NEIELOOT_02269 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 319

 Score =  315 bits (808), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 221/326 (67%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP + +SN DL   VDTSD WI  R GI  RH+A ++E T+ L   AA
Sbjct: 1   MQYAKILGSGSYLPEKRVSNDDLAEFVDTSDEWIVSRTGIKFRHLAAENERTSDLAVIAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A ++ ++IDLI++AT+TPD  FPSTA  +QN+LG+    AFD+QAVC+GF+YA+
Sbjct: 61  QRALADAGVAAEEIDLIVLATATPDMQFPSTATIVQNKLGIAGCAAFDVQAVCAGFMYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA++YI+SG+ ++ +VIG++TFS I+DW DR+TCVLFGDGAGA++L      G+S  + 
Sbjct: 121 VTANAYIKSGMAKKALVIGAETFSHILDWKDRTTCVLFGDGAGAVVL------GAS-DEE 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+   L +DG Y+D L V    +  +  G   + M+G  VFK+AV+   ++ E+V +  
Sbjct: 174 GIIHGKLQADGGYLDLLKVPAQMAGGQICGNPYVEMDGPGVFKFAVKTLAKVAEEVLEEA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
               E IDW VPHQAN RII+S    + +  DKVI+TV  HGNTSAAS+PLAL   +K G
Sbjct: 234 GYHAEQIDWLVPHQANKRIIDSTAKHLGLSLDKVILTVQNHGNTSAASVPLALDEGIKSG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+G  LLLE +GGGFT G VLLR+
Sbjct: 294 RIKRGQILLLEGIGGGFTWGAVLLRY 319


>gi|255065806|ref|ZP_05317661.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria sicca ATCC
           29256]
 gi|255050124|gb|EET45588.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria sicca ATCC
           29256]
          Length = 320

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 227/327 (69%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA + E T+ L   A+
Sbjct: 1   MQYAKILGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADEAEKTSDLAAEAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ D+IDLIIVAT+TPD  FPSTA  +Q +LG++ G  AFD+QAVC+GF+YA
Sbjct: 61  RRALVAAGVAADEIDLIIVATATPDMQFPSTATIVQQKLGIENGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           ++TA++YI+SG+ ++ +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L      G+S  +
Sbjct: 121 LSTANAYIKSGMAKKALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL------GAS-DE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+D L V G  +  +  G   ++M+G  VFK+AV+   ++ ++V   
Sbjct: 174 AGIIHSKLKADGNYLDLLNVPGQIANGQVCGSPYVKMDGPGVFKFAVKMLAKIADEVISE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + IDW VPHQAN RII+S    + +  +KVI+TV  HGNTSAASIPLAL V ++ 
Sbjct: 234 AGYTPDEIDWLVPHQANKRIIDSTAKHLGLDMEKVILTVQEHGNTSAASIPLALDVGIQN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLVKY 320


>gi|190573057|ref|YP_001970902.1| 3-oxoacyl-(acyl carrier protein) synthase III [Stenotrophomonas
           maltophilia K279a]
 gi|190010979|emb|CAQ44588.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III
           [Stenotrophomonas maltophilia K279a]
          Length = 325

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 163/328 (49%), Positives = 222/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N+DLE +V+TSD WI+ R GI  RHIA + ETT+ LG  AA 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNADLEKMVETSDEWIQSRTGIRERHIAAEGETTSDLGYQAAL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    +D+I+V T+TPD  FPSTA  IQ +LG+    AFD+ A CSGFV+A+ 
Sbjct: 65  RALEAAGIDASQLDMIVVGTTTPDLIFPSTACLIQAKLGVAGCPAFDVNAACSGFVFALG 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +IRSG  R V+VIG++T +R+VDW+DR+TCVLFGDGAGA++L+  E       +TG
Sbjct: 125 VADKFIRSGDCRHVLVIGTETLTRMVDWNDRTTCVLFGDGAGAVVLKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G ST     +   G I M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWNPVGVSTGFKDGANGGGTINMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++ +  D+V+VTVD HGNTS+ S+PLAL  AV+
Sbjct: 238 ANGLDKSDLDWLIPHQANLRIIEATAKRLDMSMDQVVVTVDKHGNTSSGSVPLALDAAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVERGQLLLLEAFGGGFTWGSALLRY 325


>gi|260753479|ref|YP_003226372.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
 gi|258552842|gb|ACV75788.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis NCIMB 11163]
          Length = 323

 Score =  315 bits (806), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 226/326 (69%), Gaps = 7/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           M RS + G G  LP+  LSN +L     +DTSD WI  R GI  RHIA  DETT +L   
Sbjct: 3   MRRSAIIGTGSVLPKTRLSNDELAQNYHIDTSDAWIVERTGIRFRHIADSDETTGTLATE 62

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL +A ++ +++ LIIVAT+TPD T P+TA+++Q  LG+    AFD+QAVCSGF+Y
Sbjct: 63  AARRALKNANVAPEEVGLIIVATTTPDYTLPATAMSVQADLGVGDSIAFDVQAVCSGFLY 122

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS +R+   +  +VIG++TF+R+++W DR+TCVLFGDGAGA++L     + +   
Sbjct: 123 ALSVADSMLRTDSAKVALVIGAETFTRLLNWEDRTTCVLFGDGAGAVVL-----RQTDDV 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GI +  L +DG Y D L  DGG ST+ TVG + M+G+ VF++AV   V + E+   ++
Sbjct: 178 EKGIQTVKLHADGRYKDLLCSDGGVSTTGTVGKLLMKGREVFRHAVTNLVSVTEEALTAS 237

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             +   +DW VPHQAN RI+++   K+ +P ++V++TVD H NT+AAS+PLAL  AV++G
Sbjct: 238 GFSASQVDWIVPHQANARILSATAQKLGVPSEQVVMTVDRHANTAAASVPLALDAAVQDG 297

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K GD ++LEAMGGGFT G  ++R+
Sbjct: 298 RIKSGDLVVLEAMGGGFTWGAAVIRF 323


>gi|326402444|ref|YP_004282525.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Acidiphilium
           multivorum AIU301]
 gi|325049305|dbj|BAJ79643.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Acidiphilium
           multivorum AIU301]
          Length = 320

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 225/324 (69%), Gaps = 4/324 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ + G+G  LP R+++N +L + +DTSD WI+ R GI +RHIA   ET   +G  AA
Sbjct: 1   MQRTVLEGVGSYLPERIVTNDELATRIDTSDAWIRERTGIGQRHIAAAHETATFMGAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A  S D +D +IVATSTPDQ FP+TAV+IQ  +GM RGFAFD+ A CSGFVY V
Sbjct: 61  RRALAAAGASADSVDAVIVATSTPDQGFPATAVSIQAAIGMTRGFAFDLSAACSGFVYGV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+ IR+G  R  +VIG++ +SRI++W DRSTCVLFGDGAGA++L      G+   D 
Sbjct: 121 SVADAMIRAGQCRSALVIGTEVYSRILNWEDRSTCVLFGDGAGAVLLR----AGTGEDDR 176

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST++ SDG Y D L++DG          + M G+ VF++AV K    +++   +  L
Sbjct: 177 GVISTHIHSDGRYGDILFIDGATGQDDRPQHLVMNGREVFRHAVSKLAGAVDEALAANDL 236

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  +IDW VPHQAN RII+++  ++ +  ++V+VTVD H NTSAASIPLAL  AV++GR+
Sbjct: 237 TQADIDWLVPHQANRRIIDAMGKRLGLAPEQVVVTVDRHANTSAASIPLALDEAVRDGRI 296

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  +L+EA+GGG T G+ L+R+
Sbjct: 297 RRGHLVLIEALGGGLTWGSALIRF 320


>gi|21230475|ref|NP_636392.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|188992737|ref|YP_001904747.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. campestris str. B100]
 gi|34098583|sp|Q8PBV1|FABH_XANCP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|21112040|gb|AAM40316.1| beta-ketoacyl-[ACP] synthase III [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|167734497|emb|CAP52707.1| 3-oxoacyl-[acyl-carrier protein] synthase III [Xanthomonas
           campestris pv. campestris]
          Length = 325

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 221/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI+ R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIRSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGLDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|221234369|ref|YP_002516805.1| 3-oxoacyl-(acyl carrier protein) synthase III [Caulobacter
           crescentus NA1000]
 gi|220963541|gb|ACL94897.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caulobacter
           crescentus NA1000]
          Length = 325

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/323 (51%), Positives = 221/323 (68%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G+G  LP +V++N DL   VDTSD WI  R GI +RH A  D+  + L   AA
Sbjct: 3   VVRSVVTGVGAYLPSKVVTNDDLAKFVDTSDEWIVERTGIRQRHQAADDQPVSDLAFEAA 62

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++AL  A  +  D+DLIIVAT+T D TFP+TA  +Q +LG   G AFD+QAVCSGFVYA+
Sbjct: 63  KEALAAAGKTAADVDLIIVATTTGDLTFPATATIVQRKLGAPVGVAFDVQAVCSGFVYAM 122

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++  G  +  +VIG++  +R++DWSDR TCVLFGDGAGA++LE  E +G++  D 
Sbjct: 123 SVADGFVARGHSKCALVIGAEAMTRLMDWSDRGTCVLFGDGAGAIVLEPGEGEGTT-DDR 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L   L +DG+  D LYVDGGPST+ TVG +RM G  VFK+AV    E I        +
Sbjct: 182 GMLGFALRADGTKQDLLYVDGGPSTTGTVGKLRMLGNQVFKHAVVNISEAIHAAAGKAGV 241

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            + ++DWF+PHQAN RI+  +  +  I  +KVI TV IH NTSAASIPLA A  +K+GR+
Sbjct: 242 AVADVDWFIPHQANQRILQGVAHRCGIDEEKVISTVAIHANTSAASIPLAFAHGIKDGRI 301

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KKGD LLLEAMGGG T G  ++R
Sbjct: 302 KKGDLLLLEAMGGGLTWGACVVR 324


>gi|261363906|ref|ZP_05976789.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria mucosa
           ATCC 25996]
 gi|288567909|gb|EFC89469.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria mucosa
           ATCC 25996]
          Length = 320

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/327 (48%), Positives = 227/327 (69%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA + E T+ L   A+
Sbjct: 1   MQYAKILGTGSYLPANRVSNDDLAKKVDTSDEWITTRTGIKFRHIADESEKTSDLAAEAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ D+IDLIIVAT+TPD  FPSTA  +Q +LG++ G  AFD+QAVC+GF+YA
Sbjct: 61  RRALVSAGVAADEIDLIIVATATPDMQFPSTATIVQQKLGIENGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           ++TA++YI+SG+ ++ +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L      G+S  +
Sbjct: 121 LSTANAYIKSGMAKKALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL------GAS-DE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+D L V G  +  +  G   ++M+G  VFK+AV+   ++ ++V   
Sbjct: 174 AGIIHSKLKADGNYLDLLNVPGQIANGQVCGSPYVKMDGPGVFKFAVKMLAKIADEVISE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T + I+W VPHQAN RII++    + +  +KVI+TV  HGNTSAASIPLAL V ++ 
Sbjct: 234 AGYTPDQINWLVPHQANKRIIDATAKHLGLDMEKVILTVQEHGNTSAASIPLALDVGIQN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLVKY 320


>gi|56552795|ref|YP_163634.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis ZM4]
 gi|56544369|gb|AAV90523.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis ZM4]
          Length = 323

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 226/326 (69%), Gaps = 7/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           M RS + G G  LP+  LSN +L     +DTSD WI  R GI  RHIA  DETT +L   
Sbjct: 3   MRRSAIIGTGSVLPKTRLSNDELAQNYHIDTSDAWIVERTGIRFRHIADSDETTGTLATE 62

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL +A ++ +++ LIIVAT+TPD T P+TA+++Q  LG+    AFD+QAVCSGF+Y
Sbjct: 63  AARRALKNANVAPEEVGLIIVATTTPDYTLPATAMSVQADLGVGDCIAFDVQAVCSGFLY 122

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS +R+   +  +VIG++TF+R+++W DR+TCVLFGDGAGA++L     + +   
Sbjct: 123 ALSVADSMLRTDSAKVALVIGAETFTRLLNWEDRTTCVLFGDGAGAVVL-----RQTDDV 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GI +  L +DG Y D L  DGG ST+ TVG + M+G+ VF++AV   V + E+   ++
Sbjct: 178 EKGIQTVKLHADGRYKDLLCSDGGVSTTGTVGKLLMKGREVFRHAVTNLVSVTEEALTAS 237

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             +   +DW VPHQAN RI+++   K+ +P ++V++TVD H NT+AAS+PLAL  AV++G
Sbjct: 238 GFSASQVDWVVPHQANARILSATAQKLGVPSEQVVMTVDRHANTAAASVPLALDAAVQDG 297

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K GD ++LEAMGGGFT G  ++R+
Sbjct: 298 RIKSGDLVVLEAMGGGFTWGAAVIRF 323


>gi|16125618|ref|NP_420182.1| 3-oxoacyl-(acyl carrier protein) synthase III [Caulobacter
           crescentus CB15]
 gi|34098690|sp|Q9A8I4|FABH_CAUCR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|13422722|gb|AAK23350.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caulobacter
           crescentus CB15]
          Length = 322

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 167/322 (51%), Positives = 220/322 (68%), Gaps = 1/322 (0%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +RS V G+G  LP +V++N DL   VDTSD WI  R GI +RH A  D+  + L   AA+
Sbjct: 1   MRSVVTGVGAYLPSKVVTNDDLAKFVDTSDEWIVERTGIRQRHQAADDQPVSDLAFEAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +AL  A  +  D+DLIIVAT+T D TFP+TA  +Q +LG   G AFD+QAVCSGFVYA++
Sbjct: 61  EALAAAGKTAADVDLIIVATTTGDLTFPATATIVQRKLGAPVGVAFDVQAVCSGFVYAMS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++  G  +  +VIG++  +R++DWSDR TCVLFGDGAGA++LE  E +G++  D G
Sbjct: 121 VADGFVARGHSKCALVIGAEAMTRLMDWSDRGTCVLFGDGAGAIVLEPGEGEGTT-DDRG 179

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           +L   L +DG+  D LYVDGGPST+ TVG +RM G  VFK+AV    E I        + 
Sbjct: 180 MLGFALRADGTKQDLLYVDGGPSTTGTVGKLRMLGNQVFKHAVVNISEAIHAAAGKAGVA 239

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
           + ++DWF+PHQAN RI+  +  +  I  +KVI TV IH NTSAASIPLA A  +K+GR+K
Sbjct: 240 VADVDWFIPHQANQRILQGVAHRCGIDEEKVISTVAIHANTSAASIPLAFAHGIKDGRIK 299

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
           KGD LLLEAMGGG T G  ++R
Sbjct: 300 KGDLLLLEAMGGGLTWGACVVR 321


>gi|148259289|ref|YP_001233416.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidiphilium cryptum
           JF-5]
 gi|166971533|sp|A5FV65|FABH_ACICJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|146400970|gb|ABQ29497.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Acidiphilium cryptum
           JF-5]
          Length = 320

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 224/324 (69%), Gaps = 4/324 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ + G+G  LP R+++N +L + +DTSD WI+ R GI +RHIA   ET   +G  AA
Sbjct: 1   MQRTVLEGVGSYLPERIVTNHELATRIDTSDAWIRERTGIGQRHIAAAHETATFMGAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A  S D +D +IVATSTPDQ FP+TAV+IQ  +GM RGFAFD+ A CSGFVY V
Sbjct: 61  RRALAAAGASADSVDAVIVATSTPDQGFPATAVSIQAAIGMTRGFAFDLSAACSGFVYGV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+ IR+G  R  +VIG++ +SRI++W DR TCVLFGDGAGA++L      G+   D 
Sbjct: 121 SVADAMIRAGQCRSALVIGTEVYSRILNWEDRGTCVLFGDGAGAVLLR----AGTGEDDR 176

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST++ SDG Y D L++DG          + M G+ VF++AV K    +++   +  L
Sbjct: 177 GVISTHIHSDGRYGDILFIDGATGQDDRPQHLVMNGREVFRHAVSKLAGAVDEALAANDL 236

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T  +IDW VPHQAN RII+++  ++ +  ++V+VTVD H NTSAASIPLAL  AV++GR+
Sbjct: 237 TQADIDWLVPHQANRRIIDAMGKRLGLAPEQVVVTVDRHANTSAASIPLALDEAVRDGRI 296

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  +L+EA+GGG T G+ L+R+
Sbjct: 297 RRGHLVLIEALGGGLTWGSALIRF 320


>gi|221068700|ref|ZP_03544805.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Comamonas
           testosteroni KF-1]
 gi|220713723|gb|EED69091.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Comamonas
           testosteroni KF-1]
          Length = 326

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 220/324 (67%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R L+N+DL     +  ++TSD WI  R GI  RH A  D T++ L   A+R 
Sbjct: 9   GTGSYLPPRRLTNNDLAAELAQRGLETSDEWIVERTGIRARHFAEPDVTSSDLALEASRK 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYAVT 121
           A+  A +   DIDLIIVATSTPD  FPSTA  +Q++LG+  G  AFD+QAVCSGFVYA+T
Sbjct: 69  AIEAAGIEASDIDLIIVATSTPDMVFPSTAAILQHKLGISNGCPAFDVQAVCSGFVYALT 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            ADS I+SG  +RV+V+GS+ FSRI+D++DR+TCVLFGDGAGA++LE  +       + G
Sbjct: 129 VADSMIQSGAAKRVLVVGSEVFSRILDFNDRTTCVLFGDGAGAVVLEASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS++  L V G  S    +G   ++M+G+AVFK AV    +    V +   
Sbjct: 182 ILSTELHADGSHVGILCVPGNVSGGNVLGDPLLKMDGQAVFKLAVSVLDKAARSVLEKAG 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT  +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL   V+ G+
Sbjct: 242 LTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQHGNTSAASIPLALDHGVRSGQ 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           VKKG  +LLE +GGGFT G VLL+
Sbjct: 302 VKKGQTVLLEGVGGGFTWGAVLLK 325


>gi|254521688|ref|ZP_05133743.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Stenotrophomonas sp.
           SKA14]
 gi|219719279|gb|EED37804.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Stenotrophomonas sp.
           SKA14]
          Length = 326

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 160/328 (48%), Positives = 222/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N+DLE +V+TSD WI+ R GI  RHIA + ETT+ LG  AA 
Sbjct: 6   IYSRIAGTGSYLPEKVLTNADLEKMVETSDEWIQSRTGIRERHIAAEGETTSDLGYQAAL 65

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    +D+I+V T+TPD  FPSTA  IQ +LG+    AFD+ A CSGFV+A+ 
Sbjct: 66  RALEAAGIDASQLDMIVVGTTTPDLIFPSTACLIQAKLGVAGCPAFDVNAACSGFVFALG 125

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +IRSG  + V+VIG++T +R+VDW+DR+TCVLFGDGAGA++L+  E       +TG
Sbjct: 126 VADKFIRSGDCKHVLVIGTETLTRMVDWNDRTTCVLFGDGAGAVVLKADE-------ETG 178

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST++ +DGS  + L+   G ST     +   G I M+G  VFKYAV+    ++++   
Sbjct: 179 ILSTHMHADGSKKELLWNPVGVSTGFKDGANGGGTINMKGNDVFKYAVKALDSVVDETLA 238

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++ +  D+V+VTVD HGNTS+ S+PLAL  AV+
Sbjct: 239 ANGLDKSDLDWLIPHQANLRIIEATAKRLDMSMDQVVVTVDKHGNTSSGSVPLALDAAVR 298

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G+V++G  LLLEA GGGFT G+ LLR+
Sbjct: 299 SGKVERGQLLLLEAFGGGFTWGSALLRY 326


>gi|167949656|ref|ZP_02536730.1| 3-oxoacyl-(acyl carrier protein) synthase III [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 302

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 213/311 (68%), Gaps = 16/311 (5%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI S + G G  LP ++L+N DLE IVDT+D WI  R GI +RHIAG +E T  L E AA
Sbjct: 1   MIYSRIIGTGSYLPEKILTNQDLEKIVDTTDQWIVERTGIKKRHIAGDEEYTCDLAEKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R+A+  A +   DIDLIIVAT+TPDQ FPSTA  +Q RLG+    AFD+QAVC+GFVYA+
Sbjct: 61  RNAMQMAGIDAKDIDLIIVATTTPDQVFPSTACLLQGRLGIHGPAAFDVQAVCTGFVYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +I++G  +R +VIG++T SRI DW+DR+TCVLFGDGAGA++LE  +       + 
Sbjct: 121 SVADKFIKTGSAKRALVIGAETLSRITDWNDRNTCVLFGDGAGAVVLEASD-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIR-------MEGKAVFKYAVEKAVELIEK 233
           GI+ST+L +DG++ + L V  G   SR  G +R       M G  VFK AV     ++++
Sbjct: 174 GIISTHLHADGAFENMLRVPSG--ISRNYGALREGNAFMEMRGNEVFKMAVTTLGRIVDE 231

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
             ++ ++   ++DW +PHQAN RII +   K++ P ++V+VTV  HGNTSAAS+PLAL  
Sbjct: 232 TLEANNMQKSDVDWLIPHQANIRIIQATARKLRTPMEQVVVTVHEHGNTSAASVPLALDT 291

Query: 294 AVKEGRVKKGD 304
           AV++ R+K+G+
Sbjct: 292 AVRDARIKRGE 302


>gi|149926449|ref|ZP_01914710.1| 3-oxoacyl-(acyl carrier protein) synthase [Limnobacter sp. MED105]
 gi|149824812|gb|EDM84026.1| 3-oxoacyl-(acyl carrier protein) synthase [Limnobacter sp. MED105]
          Length = 325

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 160/327 (48%), Positives = 223/327 (68%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G SLPRR +SN +L        V+TS  WI+ R GI +R++   DET   +   
Sbjct: 5   SAILGTGASLPRRAVSNQELTEFLANKGVETSAEWIETRTGIKQRYLCEADETNCQMASK 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AA  AL+ A +  D +DLI++ATSTPDQ FPSTA  +Q  +G K+  AFD+QAVCSGFVY
Sbjct: 65  AALQALNAAGVFPDQVDLIVLATSTPDQVFPSTACAVQAEIGAKKAMAFDIQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T ADS IRSG VR  +VIGS+ FSR++DWSDR+TCVLFGDGAGA+ L+  +       
Sbjct: 125 ALTVADSMIRSGQVRNALVIGSEVFSRLMDWSDRTTCVLFGDGAGAVFLQASD------- 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
           + GIL   L SDG+    L   G     + VG   +RM+G+AVF+ AV        ++F+
Sbjct: 178 EPGILGCKLHSDGTLGCILNTTGRIDGGKIVGDPFLRMDGQAVFRQAVSVLGSNALELFE 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           S +  +E++D+ VPHQAN RI++S+  K+K+P +++++TV +HGNTSAAS+PLAL  AV+
Sbjct: 238 SLNFKLEDLDFLVPHQANVRILHSVAKKLKLPEERIVITVGMHGNTSAASVPLALNHAVE 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           + ++KKGD +LL+ +GGGFT G+VL+R
Sbjct: 298 QKQIKKGDNVLLQGVGGGFTWGSVLVR 324


>gi|58617319|ref|YP_196518.1| 3-oxoacyl-[acyl carrier protein] synthase III [Ehrlichia
           ruminantium str. Gardel]
 gi|75432682|sp|Q5FFP2|FABH_EHRRG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|58416931|emb|CAI28044.1| 3-oxoacyl-[acyl carrier protein] synthase III [Ehrlichia
           ruminantium str. Gardel]
          Length = 319

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 151/323 (46%), Positives = 225/323 (69%), Gaps = 5/323 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS + GIG  LP+ +++N +L   V+TSD WI +R GI +R+IA  D+ T+ +   AA
Sbjct: 1   MRRSRILGIGSYLPKSLVTNDELACTVETSDEWIVKRTGIRQRYIAADDQMTSDMAVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL+ + ++  D+DLI+VAT+TPD+TFPS A  +Q++L  K  FAFD+QAVCSGF+YA+
Sbjct: 61  KLALNDSGINKQDVDLIVVATTTPDRTFPSCATIVQSKLECKNAFAFDIQAVCSGFIYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD++I+SG V   +VIG++  SRI+DW DRSTCVLFGDGAGA++L       +S  +T
Sbjct: 121 AIADNFIKSGQVNVSLVIGAEVMSRILDWKDRSTCVLFGDGAGAVVLS-----NNSARNT 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST L SDG+  + LY  GG + +   G I M G  VF++A+EK    I ++ +  +L
Sbjct: 176 GVISTILYSDGTLHNLLYTSGGTAYNGVAGTICMNGTVVFEHAIEKLSASIVEILNKNNL 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +I+ ++WFV HQAN RII  +  ++KIP +K++++++ H NTSAASIPLAL+ A   G++
Sbjct: 236 SIDEVNWFVLHQANIRIIELVARRLKIPSEKMVISINQHANTSAASIPLALSYAKNSGKL 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K+ D ++L A+G G T G  L+R
Sbjct: 296 KQDDLVILAAIGAGITWGVCLVR 318


>gi|146329454|ref|YP_001210090.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dichelobacter
           nodosus VCS1703A]
 gi|189037891|sp|A5EXD7|FABH_DICNV RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|146232924|gb|ABQ13902.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dichelobacter
           nodosus VCS1703A]
          Length = 322

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 218/329 (66%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+ S + G G  LP R++SN +L   + TSD WI  R GI +RH+A  DE+ + +   AA
Sbjct: 1   MMYSKIIGTGGYLPSRIVSNDELSQSMQTSDEWIYSRTGIRQRHLASPDESCSDMAFYAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL +A +  D IDLIIVATSTP+  FPSTA  +Q+RL  +R  AFD+QA C+GF+YA+
Sbjct: 61  KRALENAHIEADAIDLIIVATSTPEHIFPSTATVVQSRLSCQRAAAFDVQAACTGFMYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD +I+SG  + V+VIG++ FSRIVDW DR+T VLFGDGAGA++L   E       + 
Sbjct: 121 NTADCFIKSGQYQNVLVIGAEVFSRIVDWQDRNTAVLFGDGAGAVVLSASE-------EA 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRT-----VGCIRMEGKAVFKYAVEKAVELIEKVF 235
           GIL T L +DGS+ + L+V  G  +S T        I M+G+ VFK+AV     L+ ++ 
Sbjct: 174 GILGTILHADGSHKELLWVPQGIGSSETDFATRRPFIEMQGREVFKFAVRSLTHLVSELL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
               ++ + ID+ +PHQAN RII ++ + + +P +KVI+TV+ H NTSAAS+PLAL   V
Sbjct: 234 VQCQMSADEIDFLIPHQANSRIIQAVAEHLNLPIEKVIITVNQHANTSAASVPLALDYGV 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + G +K+GD LLLEA GGGFT G  +L +
Sbjct: 294 QNGIIKRGDNLLLEAFGGGFTWGGCILTY 322


>gi|241762467|ref|ZP_04760544.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
 gi|241372969|gb|EER62636.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Zymomonas mobilis
           subsp. mobilis ATCC 10988]
          Length = 323

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 225/326 (69%), Gaps = 7/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           M RS + G G  LP+  LSN +L     +DTSD WI  R GI  RHIA  DETT +L   
Sbjct: 3   MRRSAIIGTGSVLPKTRLSNDELAQNYHIDTSDAWIVERTGIRFRHIADSDETTGTLATE 62

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL +A ++ +++ LIIVAT+TPD T P+TA+++Q  LG+    AFD+QAVCSGF+Y
Sbjct: 63  AARRALKNANVAPEEVGLIIVATTTPDYTLPATAMSVQADLGVGDCIAFDVQAVCSGFLY 122

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS +R+   +  +VIG++TF+R+++W DR+TCVLFGDGAGA++L     + +   
Sbjct: 123 ALSVADSMLRTDSAKVALVIGAETFTRLLNWEDRTTCVLFGDGAGAVVL-----RQTDDV 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GI +  L +DG Y D L  DGG ST+ TVG + M+G+ VF++AV   V + E+    +
Sbjct: 178 EKGIQTVKLHADGRYKDLLCSDGGVSTTGTVGKLLMKGREVFRHAVTNLVSVTEEALTVS 237

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             +   +DW VPHQAN RI+++   K+ +P ++V++TVD H NT+AAS+PLAL  AV++G
Sbjct: 238 GFSASQVDWVVPHQANARILSATAQKLGVPSEQVVMTVDRHANTAAASVPLALDAAVQDG 297

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K GD ++LEAMGGGFT G  ++R+
Sbjct: 298 RIKSGDLVVLEAMGGGFTWGAAVIRF 323


>gi|269467947|gb|EEZ79682.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [uncultured SUP05
           cluster bacterium]
          Length = 314

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 157/317 (49%), Positives = 218/317 (68%), Gaps = 11/317 (3%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP ++++N DLE I+DTSD WI  R GI  R     DETT  L   A+ +AL  A
Sbjct: 9   GTGSYLPPKIVTNHDLEKILDTSDEWIVARTGIKERRRV-TDETTCDLATIASNNALEAA 67

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            ++  ++DLII+AT+TPD+ FP+TA  +QN +G     AFD+Q+VCSGF+YA+TTA+ +I
Sbjct: 68  GINASELDLIILATTTPDKIFPATATILQNAIGASCP-AFDLQSVCSGFIYALTTAEQFI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G   +V+V+GS+T SRIVDW DRST +LFGDGAGA++L G E       +TGIL + L
Sbjct: 127 KTGAANKVLVVGSETLSRIVDWKDRSTAILFGDGAGAVVLSGDE-------ETGILHSKL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            SDGSY+  L V    +     G I M G  VFK AV +   L E+     +++ + +DW
Sbjct: 180 FSDGSYLSSLQVSN--NYINETGYIEMAGNEVFKIAVNRLSSLAEETLKECNMSTDELDW 237

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
            VPHQAN RII+++  ++K P +KV+VT++ HGNTSAASIPLAL VAV++GR+KKGD LL
Sbjct: 238 MVPHQANIRIISAVAKRIKTPMEKVVVTLNKHGNTSAASIPLALDVAVRDGRIKKGDNLL 297

Query: 308 LEAMGGGFTSGTVLLRW 324
            E +GGGF+ G+ L+++
Sbjct: 298 FEGIGGGFSWGSALVQF 314


>gi|325919098|ref|ZP_08181157.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas gardneri
           ATCC 19865]
 gi|325550407|gb|EGD21202.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas gardneri
           ATCC 19865]
          Length = 325

 Score =  311 bits (797), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A +S D+IDLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  KAMEAAGVSADEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
             D +IRSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA++L+  E       +TG
Sbjct: 125 VGDKFIRSGAAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVVLKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGVLLMKGSEVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++++P D+V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGLGKGDLDWLIPHQANMRIIEATAKRLELPMDQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|118602495|ref|YP_903710.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
 gi|118567434|gb|ABL02239.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus Ruthia
           magnifica str. Cm (Calyptogena magnifica)]
          Length = 314

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 155/317 (48%), Positives = 216/317 (68%), Gaps = 11/317 (3%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  +++N DL   +DT++ WI  R GI +RH    +ETT +L E AA  AL  A
Sbjct: 9   GTGSYLPSTIVTNDDLSKTIDTTNEWIITRTGIKQRHKV-TNETTCNLAEKAANHALQMA 67

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   D+DLII+AT+TPD+ FP+TA  +Q  +G     AFD+Q+VC+GF++A+TTA+ YI
Sbjct: 68  GIDAKDLDLIILATTTPDKIFPATATMLQTAIGASCP-AFDLQSVCAGFIFALTTAEQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G   +V+V+GS+T SRIV+W+DRST VLFGDGAGA++L G         DTGIL + L
Sbjct: 127 KTGAANKVLVVGSETLSRIVNWNDRSTAVLFGDGAGAVVLSGSN-------DTGILHSKL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            SDGSY+  L V    +    +G I M G  VFK AV +   L E      +L  + +DW
Sbjct: 180 FSDGSYLSSLQVSN--NYINEIGFIEMSGNEVFKIAVNRLSSLAEDTLKEANLNSDKLDW 237

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
            VPHQAN RII++++ ++KIP +KVIVT++ HGNTSAASIPLAL  AV++GR+KKGD LL
Sbjct: 238 MVPHQANIRIISAVIKRIKIPINKVIVTLENHGNTSAASIPLALDTAVRDGRIKKGDSLL 297

Query: 308 LEAMGGGFTSGTVLLRW 324
            E +G GF+ G++L+++
Sbjct: 298 FEGIGAGFSWGSILVQF 314


>gi|83593002|ref|YP_426754.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodospirillum
           rubrum ATCC 11170]
 gi|123526634|sp|Q2RTS8|FABH_RHORT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|83575916|gb|ABC22467.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodospirillum
           rubrum ATCC 11170]
          Length = 324

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 227/324 (70%), Gaps = 2/324 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS + G G  LP   ++N++L   V+T+D WI+ R GI  RH A + E T+ L  AAA
Sbjct: 1   MWRSVIAGCGSYLPANKVTNANLAERVETTDAWIRERTGILVRHFAAEGEKTSDLAMAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   ++DLI++AT+TPDQTFP+TA  +Q  LG + G  AFD+QAVCSGF+YA
Sbjct: 61  RAALADAGVDAAEVDLIVLATATPDQTFPATATRVQAGLGCRPGAPAFDIQAVCSGFLYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           ++ AD+ I++G  R  +VIG++TFSRI+D++DR+TCVLFGDGAGA++L      G    +
Sbjct: 121 LSVADALIKAGQARTALVIGAETFSRILDFTDRTTCVLFGDGAGAVVLRATPSTGDG-GE 179

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            GILST+L +DG + D LYVDGGPS++ TVG +RM+G+ VF++AV    E++ +   +  
Sbjct: 180 RGILSTHLHADGRHHDLLYVDGGPSSTGTVGHLRMQGREVFRHAVTNLYEVVLEALAANG 239

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L  + IDW VPHQAN RI++    K+ I   KVI T+ +H NTSAAS+PLAL  A ++GR
Sbjct: 240 LQADAIDWVVPHQANQRILDGTAKKLGIDPAKVISTIALHANTSAASVPLALCEARRDGR 299

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ G  +LLEAMGGGFT G+ L+R
Sbjct: 300 IQPGQLILLEAMGGGFTWGSALVR 323


>gi|325267822|ref|ZP_08134472.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Kingella
           denitrificans ATCC 33394]
 gi|324980703|gb|EGC16365.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Kingella
           denitrificans ATCC 33394]
          Length = 318

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 219/325 (67%), Gaps = 9/325 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP + +SN DL   +DTSD WI  R GI  RH+A  +E T+ L   AA 
Sbjct: 1   MYAQILGTGSYLPAKRVSNDDLAKRIDTSDEWITTRTGIKARHLAADNEKTSDLAVQAAL 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  AE+   +IDLIIVAT+TPD  FP+TA  +QN+LG++   AFD+QAVC+GF+YA+T
Sbjct: 61  KALEDAEIPAQEIDLIIVATATPDMQFPATATIVQNKLGIEGCPAFDVQAVCAGFMYAIT 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TA++YIRSG+ ++ +VIG+D FSRI+DW+DR+TCVLFGDGAGA++L   E       + G
Sbjct: 121 TANAYIRSGMAKKALVIGADIFSRILDWNDRATCVLFGDGAGAVVLGASE-------EAG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           I+ + L ++G+++D L V    S     G   + M+G+ VFK+AV++   + ++V     
Sbjct: 174 IIHSKLHANGAHLDLLKVPAQMSEGAVCGSPFVTMDGQGVFKFAVKQLAAVADEVITEAG 233

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
            + + IDW VPHQAN RII S    + +  +KVI+TV  H NTSAASIPLAL   +++GR
Sbjct: 234 YSADQIDWLVPHQANKRIIESTAKHLGLSMNKVILTVAEHANTSAASIPLALDAGIRDGR 293

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G  LLLE +GGGF  G VL+++
Sbjct: 294 IRRGQMLLLEGIGGGFAWGAVLMKY 318


>gi|194364647|ref|YP_002027257.1| 3-oxoacyl-(acyl carrier protein) synthase III [Stenotrophomonas
           maltophilia R551-3]
 gi|194347451|gb|ACF50574.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Stenotrophomonas
           maltophilia R551-3]
          Length = 325

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 222/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N+DLE +V+TSD WI+ R GI  RHIA + ETT+ LG  AA 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNADLEKMVETSDEWIQSRTGIRERHIAAEGETTSDLGYNAAL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +    +D+I+V T+TPD  FPSTA  IQ +LG+    AFD+ A CSGFV+A+ 
Sbjct: 65  RALEAAGIDASQLDMIVVGTTTPDLIFPSTACLIQAKLGVAGCPAFDVNAACSGFVFALG 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +IRSG  R V+VIG++T +R+VDW+DR+TCVLFGDGAGA++L+  E       +TG
Sbjct: 125 VADKFIRSGDCRYVLVIGAETLTRMVDWNDRTTCVLFGDGAGAVVLKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L SDGS  + L+   G ST     +   G I M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHSDGSKKELLWNPVGVSTGFKGGANGGGTINMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++ +  ++V+VTVD HGNTS+ S+PLAL  AV+
Sbjct: 238 ANGLDKSDLDWLIPHQANLRIIEATAKRLDMSMEQVVVTVDQHGNTSSGSVPLALDAAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G+V++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGKVERGQLLLLEAFGGGFTWGSALLRY 325


>gi|163782791|ref|ZP_02177787.1| tryptophan synthase subunit beta [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881912|gb|EDP75420.1| tryptophan synthase subunit beta [Hydrogenivirga sp. 128-5-R1-1]
          Length = 309

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 221/321 (68%), Gaps = 14/321 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           +T++G G+ LP+ VL+N DLE +VDTSD WI  R GI  R IA K+E+   +   A+  A
Sbjct: 3   TTIKGTGIYLPKDVLTNFDLEKLVDTSDEWITTRTGIKERRIA-KEESVVEMSLKASLQA 61

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L +A++  +DID++IVAT TP++ FPST   +Q  LG+KRG+AFD+ A CSGF+YA+  +
Sbjct: 62  LKNADLKAEDIDVVIVATLTPEKKFPSTGCLLQAELGVKRGYAFDLSAACSGFLYALEVS 121

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D  ++SG  +RV+V+G +  S IVDWSDRSTCVLFGDGAGA++LE      SS  ++ IL
Sbjct: 122 DGLLKSGKAKRVLVVGVEKLSEIVDWSDRSTCVLFGDGAGAVVLE------SSKGESDIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ++ + SDG+  D LY D         G I+M+G+ +FK AV    E   +V ++  ++ E
Sbjct: 176 ASRMFSDGNLWDILYAD-------KCGYIKMKGRELFKVAVRNMEEACREVLNAAEVSPE 228

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +   +PHQAN RIIN++ +K+ IP ++V V +D +GNTSAASIP+AL  AV++GR+++G
Sbjct: 229 EVALVIPHQANVRIINALAEKLGIPRERVYVNIDRYGNTSAASIPIALHEAVEQGRLRRG 288

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +L+ AMGGG T G  LLR+
Sbjct: 289 DLVLMTAMGGGLTWGATLLRY 309


>gi|114327678|ref|YP_744835.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Granulibacter
           bethesdensis CGDNIH1]
 gi|122327354|sp|Q0BTE0|FABH_GRABC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|114315852|gb|ABI61912.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Granulibacter
           bethesdensis CGDNIH1]
          Length = 322

 Score =  310 bits (793), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 221/326 (67%), Gaps = 8/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS + G+G  LP  V+SN +L   VDTSD WI+ R GI +R++A  DE+ A +   AA
Sbjct: 1   MKRSIIAGVGAYLPSTVVSNDELAKRVDTSDAWIRERTGIEQRYLATADESCAFMAARAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL HA M+ DD+D I+VATSTPDQ FP+ AV +Q  LG KRGF FD+ A CSGFVY +
Sbjct: 61  ERALAHAGMTADDVDAILVATSTPDQVFPAVAVRVQALLGAKRGFGFDLSAACSGFVYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           +  D+ IRSG  + V+VIG++ FSR++DW DR T VLFGDGAGA  L     + S+  D 
Sbjct: 121 SMGDALIRSGQAKGVLVIGAEVFSRLLDWDDRRTNVLFGDGAGAAFL-----RASTDNDD 175

Query: 181 ---GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
              GILST+L S+G + D L++DG    +   G I M G+ VF++AV K  + +E+   +
Sbjct: 176 PARGILSTHLHSEGEFGDILFIDGANGVAGHPGTIVMNGREVFRHAVGKMAQAVEEAMAA 235

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             LT  +IDW VPHQAN RII ++  K+ +P +KV+VTV+ H NTSAASIPLAL  AV++
Sbjct: 236 NDLTPADIDWLVPHQANLRIIEAMGKKLDLPPEKVVVTVNRHANTSAASIPLALNEAVQD 295

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLR 323
           GR++ G  +L+EA+GGG T G+ +LR
Sbjct: 296 GRIQPGSVVLMEALGGGLTWGSAILR 321


>gi|255021126|ref|ZP_05293179.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969540|gb|EET27049.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII
           [Acidithiobacillus caldus ATCC 51756]
          Length = 314

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 208/321 (64%), Gaps = 13/321 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S ++G G  LP RVLSN ++   VDTSD WI  R GI  RHIA  DE    +   AAR A
Sbjct: 6   SRLQGTGSYLPERVLSNDEISQRVDTSDEWIVARTGIHSRHIAAADEGVVDMATVAARRA 65

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  D +DLI+VAT+TPDQ FPSTA  +Q+RLG +   AFD+QAVC+GF+YA+ TA
Sbjct: 66  LEAAGLGADALDLIVVATTTPDQIFPSTACLLQSRLGNRGAAAFDVQAVCTGFIYALATA 125

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IRSG  R  +V+G +  SRIVDW DRSTC+LFGDGAGA++L   +V        GIL
Sbjct: 126 DRFIRSGGARHALVVGVEKMSRIVDWDDRSTCILFGDGAGAVVLSASDVP-------GIL 178

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +DG Y D L V   P  +     + M+G AVF+ AV    E++++   +  L   
Sbjct: 179 STHLHADGRYADLLQV---PVDA---DYLTMQGNAVFRMAVRTLEEIVQETLVANDLEGS 232

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           +IDW VPHQAN RII +  DK+ +P ++V+ TV  HGN SAAS+PLAL  A +    + G
Sbjct: 233 DIDWLVPHQANIRIIQATADKLGLPMERVVTTVAHHGNVSAASVPLALDDAARRHCFRPG 292

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGGFT G+ LLRW
Sbjct: 293 QRLLLEAFGGGFTWGSALLRW 313


>gi|15677747|ref|NP_274910.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           meningitidis MC58]
 gi|34098727|sp|Q9JXR6|FABH_NEIMB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|7227173|gb|AAF42246.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis MC58]
 gi|316985535|gb|EFV64482.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Neisseria
           meningitidis H44/76]
 gi|325139570|gb|EGC62110.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis CU385]
 gi|325200968|gb|ADY96423.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis H44/76]
          Length = 320

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 163/328 (49%), Positives = 218/328 (66%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
             AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  HRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VLL++
Sbjct: 293 SGQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|66769531|ref|YP_244293.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|81304514|sp|Q4URQ0|FABH_XANC8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|66574863|gb|AAY50273.1| beta-ketoacyl-[ACP] synthase III [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 325

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 160/328 (48%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI+ R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIRSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI+V T+TPD  FPSTA  +Q RLG     AFD+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVVGTTTPDLIFPSTACLLQARLGNVGCGAFDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA++L+  E       DTG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVVLKADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  L   ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+ LAL  AV+
Sbjct: 238 ANGLDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVLLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|57239299|ref|YP_180435.1| 3-oxoacyl-[acyl carrier protein] synthase III [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58579265|ref|YP_197477.1| 3-oxoacyl-[acyl carrier protein] synthase III [Ehrlichia
           ruminantium str. Welgevonden]
 gi|81557289|sp|Q5HAV9|FABH_EHRRW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|57161378|emb|CAH58302.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417891|emb|CAI27095.1| 3-oxoacyl-[acyl carrier protein] synthase III [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 319

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 151/323 (46%), Positives = 223/323 (69%), Gaps = 5/323 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + GIG  LP+ +++N DL   V TSD WI +R GI +R+IA  D+ T+ +   AA
Sbjct: 1   MRSSRILGIGSYLPKSLVTNDDLACTVATSDEWIVKRTGIRQRYIAADDQMTSDMAVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL+ + ++  D+DLI+VAT+TPD+TFPS A  +Q++L  K  FAFD+QAVCSGF+YA+
Sbjct: 61  KLALNDSGINKQDVDLIVVATTTPDRTFPSCATIVQSKLECKNAFAFDIQAVCSGFIYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD++I+SG V   +VIG++  SRI+DW DRSTCVLFGDGAGA++L       +S  +T
Sbjct: 121 AIADNFIKSGQVNVSLVIGAEVMSRILDWKDRSTCVLFGDGAGAVVLS-----NNSARNT 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST L SDG+  + LY  GG + +   G I M G  VF++A+EK    I ++ +  +L
Sbjct: 176 GVISTILYSDGTLHNLLYTSGGTAYNGVAGTICMNGTVVFEHAIEKLSASIVEILNKNNL 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +I+ ++WFV HQAN RII  +  ++KIP +K++++++ H NTSAASIPLAL+ A   G++
Sbjct: 236 SIDEVNWFVLHQANIRIIELVARRLKIPSEKMVISINQHANTSAASIPLALSYAKNSGKL 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K+ D ++L A+G G T G  L+R
Sbjct: 296 KQDDLVVLAAIGAGITWGVCLVR 318


>gi|254468037|ref|ZP_05081443.1| 3-oxoacyl-(acyl-carrier protein) synthase III [beta proteobacterium
           KB13]
 gi|207086847|gb|EDZ64130.1| 3-oxoacyl-(acyl-carrier protein) synthase III [beta proteobacterium
           KB13]
          Length = 316

 Score =  309 bits (792), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 154/323 (47%), Positives = 218/323 (67%), Gaps = 8/323 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S +   G  LP++ LSN+DLE I DTSD WI+ R GI +RHI    ++T+ L   AA
Sbjct: 1   MSYSKIVATGSFLPKKKLSNTDLEKIFDTSDEWIRTRTGIEQRHIVEDGQSTSDLAYFAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
            DA+  +    +DI+LIIVAT+TPD+ FPS A  +Q +LG+K   AFD+QAVCSGF+YA+
Sbjct: 61  LDAIEKSSYDKNDINLIIVATTTPDKIFPSVACAVQRKLGIKNIPAFDVQAVCSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTADS+I+SG+ ++++VIG+D  S I D++DRS  +L+GDGAGA+ILE  E       + 
Sbjct: 121 TTADSFIKSGMYQKILVIGADCMSTITDYTDRSNAILWGDGAGAIILEASE-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ + + S+G Y D L+V   P  ++    I M+G AVFK AV    +++++    T  
Sbjct: 174 GIIKSIINSNGEYEDLLHVPRKPKDNKP-NTIEMQGNAVFKIAVNTLDQIVDETLQGTGF 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           +  +IDW VPHQAN RI+ +   K+ +  DKVIVT++ HGNTSAASIPLAL   +  GR+
Sbjct: 233 SKGDIDWLVPHQANIRILQATAKKLDMTMDKVIVTINKHGNTSAASIPLALNEGITSGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KK + +L+EA GGGFT G+ L++
Sbjct: 293 KKNEIILMEAFGGGFTWGSSLIK 315


>gi|258592188|emb|CBE68497.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III)(KAS III) [NC10 bacterium 'Dutch sediment']
          Length = 327

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 220/333 (66%), Gaps = 15/333 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G S+P RVL+N++LE +V TSD WI  R GIS R IA  D+ T+ L E AA
Sbjct: 1   MYGSRIAGTGASVPDRVLTNAELEQMVSTSDEWIVTRTGISERRIASDDQATSDLAEGAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  + +   D+DLI+V T TPD  FPSTA  +Q RLG  R  AFD+ A C+GFVY +
Sbjct: 61  RQALEASGVDPHDLDLILVNTVTPDMFFPSTACVLQERLGASRAAAFDLMAACAGFVYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+Y+R+GV+R ++VIG+DT S++VDWSDR TCVLFGDGAGA++++       + AD 
Sbjct: 121 SVADAYLRAGVMRNILVIGADTLSKVVDWSDRGTCVLFGDGAGAVVVQ------RTTADP 174

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRM-EGKAVFKYAVEKAVELI 231
            ILST+L SDGS   +L + GG    P++ + +      IRM  G  VFK AV    E  
Sbjct: 175 AILSTHLYSDGSKGRQLIIPGGGSRQPASQKVIDEKLVTIRMPNGNEVFKTAVRSMEEAA 234

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
                +    + ++D F+ HQAN RII ++ +++ +P +++ + +D +GNTSAASIP+A+
Sbjct: 235 IAALKANGAEVSDVDLFISHQANARIIYAVAERLDLPRERIYMNIDRYGNTSAASIPIAM 294

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
             AV+ GR+K+GD LLL A GGGFT G+ L+RW
Sbjct: 295 DEAVRAGRLKRGDLLLLTAFGGGFTWGSALIRW 327


>gi|264677106|ref|YP_003277012.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Comamonas
           testosteroni CNB-2]
 gi|299530647|ref|ZP_07044062.1| 3-oxoacyl-(acyl carrier protein) synthase III [Comamonas
           testosteroni S44]
 gi|262207618|gb|ACY31716.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Comamonas
           testosteroni CNB-2]
 gi|298721163|gb|EFI62105.1| 3-oxoacyl-(acyl carrier protein) synthase III [Comamonas
           testosteroni S44]
          Length = 326

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 167/324 (51%), Positives = 219/324 (67%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R L+N+DL     +  ++TSD WI  R GI  RH A  D T++ L   A+R 
Sbjct: 9   GTGSYLPPRRLTNNDLAAELAQRGLETSDEWIVERTGIRARHFAEPDVTSSDLALEASRK 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYAVT 121
           A+  A +   DIDLIIVATSTPD  FPSTA  +Q++LG+  G  AFD+QAVCSGFVYA+T
Sbjct: 69  AIEAAGIEASDIDLIIVATSTPDMVFPSTAAILQHKLGISNGCPAFDVQAVCSGFVYALT 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            ADS I++G  +RV+V+GS+ FSRI+D++DR+TCVLFGDGAGA++LE  +       + G
Sbjct: 129 VADSMIQTGAAKRVLVVGSEVFSRILDFNDRTTCVLFGDGAGAVVLEASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           IL+T L +DGS++  L V G  S    +G   ++M+G+AVFK AV    +      +   
Sbjct: 182 ILATELHADGSHVGILCVPGNVSGGNVLGDPLLKMDGQAVFKLAVSVLDKAARSALEKAG 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           LT  +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL   V+ G+
Sbjct: 242 LTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQHGNTSAASIPLALDHGVRSGQ 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           VKKG  +LLE +GGGFT G VLL+
Sbjct: 302 VKKGQTVLLEGVGGGFTWGAVLLK 325


>gi|285017420|ref|YP_003375131.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Xanthomonas
           albilineans GPE PC73]
 gi|283472638|emb|CBA15143.1| probable 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Xanthomonas
           albilineans]
          Length = 327

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 215/330 (65%), Gaps = 14/330 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N DL  +V+TSD WI+ R GI  RHIA   +T   LG  AA 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDLSHMVETSDEWIRSRTGIRERHIAAPGQTAGDLGYEAAL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A +   ++D+I+V T+TPD  FPSTA  IQ RLG     A D+ A CSGFVYA+ 
Sbjct: 65  QAIEAAGIQAAELDMIVVGTTTPDLIFPSTACLIQARLGAVGCPALDLNAACSGFVYALG 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +IRSG  + V+VIG++  SRIVDW++R+TCVLFGDGAGA++L   E       DTG
Sbjct: 125 VADKFIRSGDAKTVLVIGTEILSRIVDWTERTTCVLFGDGAGAVVLRADE-------DTG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-------IRMEGKAVFKYAVEKAVELIEKV 234
           ILST+L +DGS  + L    G  T    G        I+M+G  VFKYAV+    ++++ 
Sbjct: 178 ILSTHLHADGSKKELLLNATGIGTGLVDGTGHLAGGGIQMKGSEVFKYAVKALDAVVDET 237

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
             +  L   ++DW +PHQAN RII +   ++ +  D+V+VTVD+HGNTS+AS+P+AL VA
Sbjct: 238 LQANGLDKHDLDWLIPHQANLRIIEATAKRLDMSMDQVVVTVDVHGNTSSASVPMALDVA 297

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V+ GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 VRSGRVQRGQLLLLEAFGGGFTWGSALLRY 327


>gi|56416963|ref|YP_154037.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Anaplasma marginale
           str. St. Maries]
 gi|81599127|sp|Q5PA98|FABH_ANAMM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|56388195|gb|AAV86782.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Anaplasma marginale
           str. St. Maries]
          Length = 322

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 220/323 (68%), Gaps = 2/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS   G+G  LP +V++N DL  +VDT+D W+ RR GI RRH+  + +T + +   AA
Sbjct: 1   MRRSVFCGVGAFLPAKVITNDDLSLMVDTTDEWVFRRTGIKRRHVVEEGDTVSCMATEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +S  ++DLIIVAT+TPD+T PS A  +Q  LG K   AFD+ A CSGF+YA+
Sbjct: 61  KIALEDAGVSATEVDLIIVATATPDKTMPSCATMVQGSLGCKNAAAFDINAACSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           +  DS I++G     ++IGS+  S++VDW+DRSTCVLFGDGAGA + +G +   +     
Sbjct: 121 SIVDSMIKAGQANIALIIGSEAMSKVVDWTDRSTCVLFGDGAGAFVFKGQD--ETEKPGA 178

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST LC+DGS  + LY +GG +++   G I M+G  +F++AV K    I  + +S+ L
Sbjct: 179 GVMSTLLCADGSLGNVLYTNGGVASTGKAGYICMKGTVLFEHAVVKLSSAISALLESSAL 238

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            +++IDWF+PHQAN RII+ +++++ +  DKVI+++D H NTS+ASIPLA+  A + GR+
Sbjct: 239 DVDSIDWFIPHQANVRIIDLVINRLGLSRDKVILSIDEHANTSSASIPLAMYEAKRAGRI 298

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KKG+ +L  A+G G T G  LLR
Sbjct: 299 KKGNLVLFAAIGAGITWGVSLLR 321


>gi|120609871|ref|YP_969549.1| 3-oxoacyl-(acyl carrier protein) synthase III [Acidovorax citrulli
           AAC00-1]
 gi|166971531|sp|A1TLD7|FABH_ACIAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120588335|gb|ABM31775.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Acidovorax citrulli
           AAC00-1]
          Length = 325

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 167/326 (51%), Positives = 215/326 (65%), Gaps = 14/326 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G SLP R L+N+DL +      V+TSD WI  R GI  RH A +D  ++ LG  
Sbjct: 5   SRITGTGSSLPPRRLTNADLVAELAGRGVETSDQWIVERTGIRARHFAERDVCSSDLGLE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A +   DIDLIIVATSTPD  FPSTA  +QN+LG     AFD+QAVCSGF+Y
Sbjct: 65  AARQALDAAGVQPADIDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFIY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T ADS IRSG  RR +V+GS+ FSR++D++DR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADSMIRSGAARRALVVGSEVFSRLLDFNDRTTCVLFGDGAGAVVLEASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V G     + +G   ++M+G+AVFK AV    +    V D
Sbjct: 180 --GILASDLHADGRHVGILCVPGNVYGGQILGDPLLKMDGQAVFKLAVGVLDKAARAVLD 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L   ++DW +PHQAN RI+     K+ +P D+V+VTVD HGNTSAASIPLAL  AV+
Sbjct: 238 KAGLKESDVDWLIPHQANIRIMQGTAKKLGLPMDRVVVTVDQHGNTSAASIPLALDHAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            G+ + G  LLLE +GGGFT G VLL
Sbjct: 298 SGQARPGQNLLLEGVGGGFTWGAVLL 323


>gi|329850594|ref|ZP_08265439.1| 3-oxoacyl-acyl-carrier-protein synthase 3 family protein
           [Asticcacaulis biprosthecum C19]
 gi|328840909|gb|EGF90480.1| 3-oxoacyl-acyl-carrier-protein synthase 3 family protein
           [Asticcacaulis biprosthecum C19]
          Length = 316

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/316 (50%), Positives = 219/316 (69%), Gaps = 2/316 (0%)

Query: 9   IGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAE 68
           +G  LP  +++N D   +VDTSD WI  R GI +RH     + T+ L   AAR AL  A 
Sbjct: 1   MGGYLPETIVTNDDFTKMVDTSDAWIIERTGIRQRHKVAPGQRTSDLAVEAARVALAAAG 60

Query: 69  MSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIR 128
            + +D+D++IVAT+TPD  FPSTA  +Q +LG +   AFD+QAVCSGFVYA+T AD ++ 
Sbjct: 61  RTPEDVDMVIVATTTPDMPFPSTASIVQQKLGTRPCAAFDVQAVCSGFVYALTVADGFVA 120

Query: 129 SGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLC 188
            G+ R V+VIG++  S+++D++DR TC+LFGDGAGA++LE VE +G+S AD GIL   L 
Sbjct: 121 RGIARCVLVIGAEAMSQLLDYTDRGTCILFGDGAGAVVLEPVEGEGTS-ADRGILGFDLQ 179

Query: 189 SDGSYIDKLYVDGGP-STSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            DGS +D LYVDGG    S  +G IRM+G  VFK+AV K  E  E     ++L++ ++DW
Sbjct: 180 CDGSKMDLLYVDGGVFEDSNRIGKIRMQGNQVFKHAVHKISEAAENAVIKSNLSMADVDW 239

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RI+N + DK+ +  DKVI TV +H NTSAASIPLA  + V++GRVK GD +L
Sbjct: 240 FIPHQANQRILNGVADKLGLDRDKVISTVAMHANTSAASIPLAWYIGVQDGRVKPGDLVL 299

Query: 308 LEAMGGGFTSGTVLLR 323
           +EA+GGG T G   +R
Sbjct: 300 IEALGGGLTWGAAAIR 315


>gi|325925307|ref|ZP_08186710.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas
           perforans 91-118]
 gi|325544298|gb|EGD15678.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas
           perforans 91-118]
          Length = 325

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++++P D+V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGFDKHDLDWLIPHQANLRIIEATAKRLELPMDQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|222475329|ref|YP_002563746.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (fabH) [Anaplasma
           marginale str. Florida]
 gi|222419467|gb|ACM49490.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (fabH) [Anaplasma
           marginale str. Florida]
          Length = 323

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 219/323 (67%), Gaps = 2/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS   G+G  LP +V++N DL  +VDT+D W+ RR GI RRH+  + +T + +   AA
Sbjct: 2   MRRSVFCGVGAFLPAKVITNDDLSLMVDTTDEWVFRRTGIKRRHVVEEGDTVSGMATKAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +S  ++DLIIVAT+TPD+T PS A  +Q  LG K   AFD+ A CSGF+YA+
Sbjct: 62  EIALEDAGVSASEVDLIIVATATPDKTMPSCATMVQGNLGCKNAAAFDINAACSGFLYAL 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           +  DS I++G     ++IGS+  S++VDW+DRSTCVLFGDGAGA + +G +   +     
Sbjct: 122 SIVDSMIKAGQANIALIIGSEAMSKVVDWTDRSTCVLFGDGAGAFVFKGQD--ETEKPGA 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G++ST LC+DGS  + LY +GG +++   G I M+G  +F++AV K    I  + +S+ L
Sbjct: 180 GVMSTLLCADGSLGNVLYTNGGVASTGKAGYICMKGTVLFEHAVVKLSSAISALLESSAL 239

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            +++IDWF+PHQAN RII+ +++++ +  DKVI+++D H NTS+ASIPLA+  A + GR+
Sbjct: 240 DVDSIDWFIPHQANVRIIDLVINRLGLSRDKVILSIDEHANTSSASIPLAMYEAKRAGRI 299

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           KKG+ +L  A+G G T G  LLR
Sbjct: 300 KKGNLVLFAAIGAGITWGVSLLR 322


>gi|21241878|ref|NP_641460.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|34098589|sp|Q8PNE8|FABH_XANAC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|21107262|gb|AAM35996.1| beta-ketoacyl-[ACP] synthase III [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 325

 Score =  307 bits (786), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  RAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNIGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           ++     ++DW +PHQAN RII +   +M++P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ASGYDKHDLDWLIPHQANLRIIEATAKRMELPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|91789500|ref|YP_550452.1| 3-oxoacyl-(acyl carrier protein) synthase III [Polaromonas sp.
           JS666]
 gi|123355352|sp|Q126I8|FABH_POLSJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|91698725|gb|ABE45554.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Polaromonas sp.
           JS666]
          Length = 325

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 216/328 (65%), Gaps = 14/328 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R L+N++L +      V+TSD WI  R GI  RH A  D +++ L   
Sbjct: 5   SRITGTGSYLPPRRLTNAELAAELATKGVETSDEWIVERTGIRARHFAAPDVSSSDLAVK 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A     DIDLIIVATSTPD  FPS A  +QN+LG+    AFD+QAVCSGFVY
Sbjct: 65  AARHALEAAGRQASDIDLIIVATSTPDMVFPSAACIVQNKLGIAGCPAFDVQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ I++G   + +VIG++ FSRI+D+SDR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADALIKTGSATKALVIGAEVFSRILDFSDRTTCVLFGDGAGAVVLEASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V G  S  + +G   ++M+G+AVFK AV            
Sbjct: 180 --GILASDLHADGKHVGILCVPGNVSGGQVLGDPLLKMDGQAVFKLAVGVLESSARAALA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
             +L   +IDW +PHQAN RI+ S   K+K+P +K+IVTVD HGNTSAASIPLAL  +V+
Sbjct: 238 KANLRDTDIDWLIPHQANIRIMQSTAKKLKVPPEKLIVTVDEHGNTSAASIPLALDASVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G+VKKGD L+LE +GGGFT G VLL +
Sbjct: 298 SGKVKKGDTLMLEGVGGGFTWGAVLLNY 325


>gi|56478540|ref|YP_160129.1| 3-oxoacyl-(acyl carrier protein) synthase III [Aromatoleum
           aromaticum EbN1]
 gi|81598590|sp|Q5P0D6|FABH_AZOSE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|56314583|emb|CAI09228.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Aromatoleum
           aromaticum EbN1]
          Length = 321

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 160/328 (48%), Positives = 225/328 (68%), Gaps = 11/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI-VDTSDGWIKRRVGISRRHIAGKDETTASLGEAA 59
           MI + + G G  LP   ++N DL +  +DTSD WI  R GI  RH+A  + +++ L + A
Sbjct: 1   MIYARIAGTGSFLPGEPITNDDLVARGIDTSDQWIIERTGIRSRHLASAEMSSSDLAKTA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFA-FDMQAVCSGFVY 118
           +  AL  A +  DDIDLIIVATSTPD  FPSTA  +Q++LG++ G A FD+QAVCSGFVY
Sbjct: 61  SERALDAAGVRPDDIDLIIVATSTPDCIFPSTAALLQSKLGIRNGAAAFDVQAVCSGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
            +T A+ +IRSG  +R +V+G++ FSRI+DWSDR TCVLFGDGAGA++LE  E  G    
Sbjct: 121 GLTIAEKFIRSGSHKRALVVGAEVFSRILDWSDRGTCVLFGDGAGAVVLEAAEAPG---- 176

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
              IL++ L +DGS+   L V G  +  + VG   +RM+G+AVFK+AV    ++  +V D
Sbjct: 177 ---ILASALHADGSHHPILCVPGAVAAGQVVGDPFLRMDGQAVFKFAVRVLGDVALEVLD 233

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +T++++DW +PHQAN RI+ +   ++ +  DKVI TVD HGNTSAASIPLAL +AV+
Sbjct: 234 QAGVTVDSVDWLIPHQANIRILQATARRLGVSMDKVITTVDHHGNTSAASIPLALDLAVR 293

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           +GR++ G   ++E +GGGFT G  LL++
Sbjct: 294 DGRIRPGHRFIIEGVGGGFTWGAALLQF 321


>gi|198283689|ref|YP_002220010.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218665102|ref|YP_002426319.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198248210|gb|ACH83803.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218517315|gb|ACK77901.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 314

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 215/323 (66%), Gaps = 13/323 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S +   G  LP R+LSN DLE +V+TSD WI  R GI  RHIA   E T  + EAAAR
Sbjct: 4   IYSRIVATGGYLPERILSNRDLEQMVETSDAWIFARTGIRSRHIAAPGEKTVDMAEAAAR 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A ++  D+DLIIVAT+TPDQ FPSTA  +Q RLG +   AFD+QAVC+GF+YA+ 
Sbjct: 64  QALADAGLNAADLDLIIVATTTPDQIFPSTACLLQARLGNRGAPAFDIQAVCTGFIYALA 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  R  +V+G ++ S IVDW+DR TC+LFGDGAGA++L       S+    G
Sbjct: 124 TADRFIRSGGARHALVVGVESMSHIVDWTDRGTCILFGDGAGAVVL-------SAGDQPG 176

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ +DG+Y D L V GG +       I M+G AVF+ AV    E++++   +  LT
Sbjct: 177 IISTHIHADGAYADLLQVPGGETR------IAMQGNAVFRVAVRTLGEIVQETLAANALT 230

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              IDW VPHQAN RII +  DK+ +P ++V+ TV+ HGNTSAAS+PLAL  A + G  +
Sbjct: 231 PAEIDWLVPHQANIRIIEATADKLGLPMERVVTTVEHHGNTSAASVPLALDEAARRGCFQ 290

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
               LLLEA GGGFT G+ LLRW
Sbjct: 291 PRQRLLLEAFGGGFTWGSALLRW 313


>gi|166710962|ref|ZP_02242169.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 325

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHIA  D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RI+DW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRILDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLRADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL VAV+
Sbjct: 238 ANGYDTHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDVAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGF  G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFAWGSALLRY 325


>gi|289664106|ref|ZP_06485687.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 325

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHIA  D+TT  L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDQTTGDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG+    A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGIVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGYDKHDLDWLIPHQANVRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|58584871|ref|YP_198444.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
 gi|75497716|sp|Q5GS22|FABH_WOLTR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|58419187|gb|AAW71202.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 326

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 224/328 (68%), Gaps = 6/328 (1%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M +S +   G  LP++ L N ++  +V+TSD WI++R GI++R+IA + E T+ L   +A
Sbjct: 1   MNKSFILSTGSYLPKKKLGNDEIALMVETSDEWIRQRTGITQRYIADEAELTSDLAVNSA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++A+  A++SVD+I LIIVAT+TPD+T PS A   QN+L  K  F+FD+QA CSGF+YAV
Sbjct: 61  KNAIEKAQISVDEIGLIIVATTTPDKTLPSCATIAQNKLKCKNAFSFDVQAACSGFIYAV 120

Query: 121 TTADSYIRSG-VVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           T ADS I+S   ++  +VIG++  SRIVDW DRSTCVLFGDGAGA+I++      + M +
Sbjct: 121 TIADSLIKSNDRIKYALVIGAEIMSRIVDWKDRSTCVLFGDGAGAVIMKST-AHCNEMTE 179

Query: 180 T---GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
               GI+ST L SDG+ +D L   GG S++   G I M G+ VFK+AV+K    IE+   
Sbjct: 180 NSTRGIISTNLYSDGN-VDVLCTKGGISSTGDSGKIYMNGREVFKHAVDKLTASIEETLR 238

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
             +L I +IDW VPHQAN RII ++V K+    +KVI TVD H NTSAASIPLAL  A++
Sbjct: 239 CNNLKITDIDWLVPHQANIRIIEAVVKKLNFLMEKVINTVDQHANTSAASIPLALDYAIQ 298

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + ++K G   +L A+G G T G+VLLR+
Sbjct: 299 KPKIKPGSLGILVAIGAGLTWGSVLLRY 326


>gi|197105122|ref|YP_002130499.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Phenylobacterium
           zucineum HLK1]
 gi|196478542|gb|ACG78070.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Phenylobacterium
           zucineum HLK1]
          Length = 326

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 219/323 (67%), Gaps = 1/323 (0%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++RS V G+G  LP R+++N DL  IV+TSD WI+ R GI +R  A  D+  + L   AA
Sbjct: 4   VLRSVVTGVGGYLPERIVTNDDLAKIVETSDEWIRERTGIRQRRQAEDDQPVSDLAVEAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A  S DD+DLI+VAT+TPD TFP+TA  +Q +LG   G AFD+QAVCSGFVYA+
Sbjct: 64  RRALAAAGRSPDDVDLIVVATTTPDLTFPATAAIVQRKLGAPVGIAFDVQAVCSGFVYAL 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD ++     +  +VIG++  +R++DW+DR TCVLFGDGAGA++LE  E +G ++AD 
Sbjct: 124 SVADGFVARRRAKCALVIGAECMTRLMDWTDRGTCVLFGDGAGAVVLEPGEGEG-AVADR 182

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+L   L +DG+  D LYVDGG ST+RT G +RM+G  VF++AV    E +        +
Sbjct: 183 GLLGFALRADGTKQDLLYVDGGVSTTRTTGYLRMQGNQVFRHAVVNISEAVVAAAADAGV 242

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            +  +DWF+PHQAN RI+  +  ++ I   KVI TV  H NTSAASIPLAL   V++GR+
Sbjct: 243 EVSAVDWFIPHQANQRILEGVARRLGIDETKVISTVAEHANTSAASIPLALDQGVQDGRI 302

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
           K G  LLLEAMGGG T G  +LR
Sbjct: 303 KPGQLLLLEAMGGGLTWGACVLR 325


>gi|258545279|ref|ZP_05705513.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cardiobacterium
           hominis ATCC 15826]
 gi|258519492|gb|EEV88351.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cardiobacterium
           hominis ATCC 15826]
          Length = 322

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 215/329 (65%), Gaps = 12/329 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI S +   G  LP+R+++N +    +DTSD WI+ R GI++RHIA  DE++  L   AA
Sbjct: 1   MIYSKILSTGSYLPQRIMTNQEFAERMDTSDEWIRTRTGIAQRHIAAPDESSTDLAYQAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           RDAL  A++    +DLIIVATSTP+  FPS A  +Q RLG +   AFDMQA CSGF++A+
Sbjct: 61  RDALQRADIDPATLDLIIVATSTPEHIFPSNASQLQTRLGCQTIAAFDMQAACSGFIFAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TAD++IR+G  +R +VIG++ FS I+DWSDRST +LFGDGAGA+ILE  +       + 
Sbjct: 121 ATADNFIRAGSCKRALVIGAELFSNILDWSDRSTSILFGDGAGAVILEAAD-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVD-GGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVF 235
           GI  + L SDG Y + L V  G  S + T+G     + MEG+ VFK AV     L+ ++ 
Sbjct: 174 GIHGSVLHSDGRYKELLLVPRGSGSAADTMGDRLPFVHMEGREVFKVAVRTLSGLVTELL 233

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           +   +  E+ID+ +PHQAN RII +  + + +P +KVI+TV  H NTSAASIPLAL   +
Sbjct: 234 EQQQMQAEDIDFLIPHQANLRIIKATAEHLNLPLEKVILTVAEHANTSAASIPLALDYGI 293

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           K G +++G  LLLEA GGGF  G  ++ +
Sbjct: 294 KNGTIRRGHKLLLEAFGGGFVWGGSIITY 322


>gi|241763838|ref|ZP_04761883.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidovorax
           delafieldii 2AN]
 gi|241366882|gb|EER61296.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidovorax
           delafieldii 2AN]
          Length = 325

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 166/327 (50%), Positives = 213/327 (65%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP   L+N+DL      S ++TSD WI  R GI  RH A  D   + L   
Sbjct: 5   SRITGTGSYLPPLRLTNADLVAQLAHSGIETSDEWIVERTGIRARHFAAPDVACSDLALE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR A+  A     DIDLIIVATSTPD  FPSTA  +QN+LG     AFD+QAVCSGFVY
Sbjct: 65  AARKAIEAAGCQPQDIDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ I++G  RR +V+G++ FSRI+D+ DR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADAMIQAGTARRALVVGAEVFSRILDFKDRTTCVLFGDGAGAVVLEASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V GG S  + +G   ++M+G+AVFK AV    +      +
Sbjct: 180 --GILASDLHADGRHVGILCVPGGVSGGQVLGDPLLKMDGQAVFKLAVGVLEKAARAALE 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
             HLT  +IDW +PHQAN RI+ S   K+ +  DKV+VTVD HGNTSAASIPLAL  AV+
Sbjct: 238 KAHLTDADIDWLIPHQANIRIMQSTARKLGLSMDKVVVTVDQHGNTSAASIPLALDHAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
            G+V+K   LLLE +GGGFT G VLL+
Sbjct: 298 TGQVQKDQTLLLEGVGGGFTWGAVLLK 324


>gi|59802462|ref|YP_209174.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae FA 1090]
 gi|194100132|ref|YP_002003272.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae NCCP11945]
 gi|239998119|ref|ZP_04718043.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae 35/02]
 gi|240013299|ref|ZP_04720212.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae DGI18]
 gi|240015745|ref|ZP_04722285.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae FA6140]
 gi|240079881|ref|ZP_04724424.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae FA19]
 gi|240112089|ref|ZP_04726579.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae MS11]
 gi|240114835|ref|ZP_04728897.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae PID18]
 gi|240117037|ref|ZP_04731099.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae PID1]
 gi|240120371|ref|ZP_04733333.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae PID24-1]
 gi|240124863|ref|ZP_04737749.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae SK-92-679]
 gi|240127378|ref|ZP_04740039.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae SK-93-1035]
 gi|254492899|ref|ZP_05106070.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           1291]
 gi|268593970|ref|ZP_06128137.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           35/02]
 gi|268596024|ref|ZP_06130191.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           FA19]
 gi|268598147|ref|ZP_06132314.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           MS11]
 gi|268600491|ref|ZP_06134658.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID18]
 gi|268602723|ref|ZP_06136890.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID1]
 gi|268683444|ref|ZP_06150306.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           SK-92-679]
 gi|268685750|ref|ZP_06152612.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           SK-93-1035]
 gi|75432309|sp|Q5F4X5|FABH_NEIG1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|254783816|sp|B4RJI1|FABH_NEIG2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|59719357|gb|AAW90762.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           gonorrhoeae FA 1090]
 gi|193935422|gb|ACF31246.1| 3-oxoacyl-(acyl carrier protein) synthase [Neisseria gonorrhoeae
           NCCP11945]
 gi|226511939|gb|EEH61284.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           1291]
 gi|268547359|gb|EEZ42777.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           35/02]
 gi|268549812|gb|EEZ44831.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           FA19]
 gi|268582278|gb|EEZ46954.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           MS11]
 gi|268584622|gb|EEZ49298.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID18]
 gi|268586854|gb|EEZ51530.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID1]
 gi|268623728|gb|EEZ56128.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           SK-92-679]
 gi|268626034|gb|EEZ58434.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           SK-93-1035]
 gi|317165562|gb|ADV09103.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae TCDC-NG08107]
          Length = 320

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 222/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A+++++DIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAKLNINDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T E IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDAGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|257093139|ref|YP_003166780.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
 gi|257045663|gb|ACV34851.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Candidatus
           Accumulibacter phosphatis clade IIA str. UW-1]
          Length = 319

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 214/323 (66%), Gaps = 10/323 (3%)

Query: 4   STVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           S + GIG  LP   +SN DL +  ++TSD W+  R GI  RH+A   E  + L   A+R 
Sbjct: 3   SRITGIGSFLPGEPVSNDDLAQRGIETSDEWVASRTGIRFRHLAENGEAASDLAFEASRR 62

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A +   D+DLI+VATSTPD  FPSTA  +Q++LG +   AFD+QAVCSGFVYA+T 
Sbjct: 63  ALTAAGIEASDVDLILVATSTPDFIFPSTACLLQSKLGNRGATAFDIQAVCSGFVYALTV 122

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           AD +I SG  RR +V+G++ FSRI+DWSDR+TCVLFGDGAGA++LE  E         GI
Sbjct: 123 ADKFICSGSHRRALVVGAEVFSRILDWSDRATCVLFGDGAGAVVLEASE-------RPGI 175

Query: 183 LSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           L+T L +DG+Y   L V G     + VG   +RM+G+AVFK+AV    E+ E+   +  +
Sbjct: 176 LATALHADGAYHGILSVPGSVCGGKVVGDPFLRMDGQAVFKFAVRVLAEVAEECCQAAGV 235

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
               IDW +PHQAN RI+ +   +MK+P  KV+VTVD HGNTSAAS+PLAL  AV++GR+
Sbjct: 236 APAGIDWLIPHQANVRILEATAKRMKLPMGKVVVTVDRHGNTSAASVPLALDEAVRDGRI 295

Query: 301 KKGDCLLLEAMGGGFTSGTVLLR 323
             G  ++LE +GGGFT G VL  
Sbjct: 296 HAGHKVMLEGVGGGFTWGAVLFE 318


>gi|74317569|ref|YP_315309.1| 3-oxoacyl-(acyl carrier protein) synthase III [Thiobacillus
           denitrificans ATCC 25259]
 gi|123611771|sp|Q3SIM4|FABH_THIDA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|74057064|gb|AAZ97504.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Thiobacillus denitrificans ATCC 25259]
          Length = 319

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 228/326 (69%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP R+L+N+DLE +VDT+D WI  R GI  RHIA   E T+ L  AAA
Sbjct: 1   MTYSRILGTGGYLPARILTNADLEKLVDTNDQWIVDRTGIRERHIAADGEFTSDLATAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ DDIDL++VAT+TPD  FPSTA  +Q++LGM  G  AFD+QAVCSGFVYA
Sbjct: 61  RAALEAANLAADDIDLLLVATTTPDLVFPSTACIVQSKLGMTNGKPAFDLQAVCSGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           ++ AD +I+ G  + V+V+G++T SRI DW+DRS C+L+GDGAGA+++      G+S ++
Sbjct: 121 LSVADQFIKGGAAKHVLVVGAETLSRITDWNDRSNCILWGDGAGAVVV------GAS-SE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPST-SRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
            GI++T++ +DG + + L    GPS+ S+T   +RMEG AVFK AV     ++++  ++ 
Sbjct: 174 PGIIATHIHADGRHKELLRTTTGPSSGSKTPALMRMEGNAVFKMAVNTLDRIVDETLEAN 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW VPHQAN RII++   K+ +  D V+ TV  HGNTSAAS+PLA   AV++G
Sbjct: 234 GLAKTDIDWLVPHQANIRIISATAKKLGMSMDNVVTTVAGHGNTSAASVPLAFDAAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+G  +L+EA GGGFT G+ LLR+
Sbjct: 294 RIKRGQIVLMEAFGGGFTWGSALLRY 319


>gi|33602733|ref|NP_890293.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella
           bronchiseptica RB50]
 gi|46576489|sp|Q7WD20|FABH_BORBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|33577175|emb|CAE35732.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Bordetella
           bronchiseptica RB50]
          Length = 329

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 161/330 (48%), Positives = 219/330 (66%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLES-----IVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  + + G G  LP RV++N DL +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 6   MKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRHLAERGVTTSQL 65

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AAR A+  A +  D+ID+IIVATSTPD  FPSTA  +Q  LG K G AFD+QAVCSG
Sbjct: 66  ATEAARRAMDDAGVQADEIDMIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+TTADS+IR+G  R  +VIG++ FSRI+DW+DR TCVLFGDGAGA++L+  +    
Sbjct: 126 FVYAMTTADSFIRAGRARCALVIGAEVFSRILDWNDRGTCVLFGDGAGAVVLKAAD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GIL+ +L +DGS    L   G  +     G   +RM+G+AVFK AV         
Sbjct: 182 ---EPGILAAHLHADGSQTKILCAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V     + +++IDW +PHQAN RI+N +  K+++P ++V++TVD H NTSAAS+PLAL V
Sbjct: 239 VCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITVDQHANTSAASVPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GRVK G  +L++ +GGGFT G+VL R
Sbjct: 299 ARRDGRVKPGQLVLMQGVGGGFTWGSVLAR 328


>gi|294627945|ref|ZP_06706524.1| 3-oxoacyl-acyl carrier synthase protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292597859|gb|EFF42017.1| 3-oxoacyl-acyl carrier synthase protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
          Length = 325

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNIGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA++L+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVVLKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           ++     ++DW +PHQAN RII +   ++++P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ASGYDKHDLDWLIPHQANLRIIEATAKRLELPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|260441349|ref|ZP_05795165.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae DGI2]
 gi|291044709|ref|ZP_06570418.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           DGI2]
 gi|291011603|gb|EFE03599.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           DGI2]
          Length = 320

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 221/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A+++++DIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAKLNINDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T E IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   +  
Sbjct: 234 AGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDAGIHS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|253699784|ref|YP_003020973.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp. M21]
 gi|251774634|gb|ACT17215.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp. M21]
          Length = 326

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 155/332 (46%), Positives = 221/332 (66%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR  + G G ++P++VL+N DLE +VDTSD WI  R GI  R IA + E T++    AA
Sbjct: 1   MIRPKITGTGSAVPQKVLTNFDLEKMVDTSDEWIVARTGIRERRIASEGEYTSTFAALAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A ++ +++DLI+V T TPD  FP+TA  +Q  +     F FD+ A CSGF+YA+
Sbjct: 61  QRALEAAGVAPEELDLIVVGTLTPDFPFPATACIVQQIIKAPNAFCFDLSAACSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+ YI SG V++ +VIG++  SRIVDW+DR+TC+LFGDGAGA++LE VE       + 
Sbjct: 121 ATAEKYILSGQVKKALVIGAEVLSRIVDWTDRNTCLLFGDGAGAVVLEAVE------GEN 174

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GILST++ SDG+Y + LY  G     P+T + +      + M+G  VFK AV    E+ +
Sbjct: 175 GILSTHMHSDGNYWEILYQKGAGSRNPATQKNLDDRLVYLTMQGNEVFKLAVRAMGEVAQ 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   +  LT +++  F+PHQAN RI++SI  ++ I  ++V V +D +GNTSAASIP+AL 
Sbjct: 235 EALAANGLTPDDVSLFIPHQANQRIVDSIGKRLGITGERVFVNLDRYGNTSAASIPIALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV+ GR+K+GD LLL+A GGG T G  L+RW
Sbjct: 295 EAVRAGRLKEGDILLLDAFGGGLTWGASLIRW 326


>gi|325917371|ref|ZP_08179586.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325536412|gb|EGD08193.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 325

 Score =  305 bits (780), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 218/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGYDKHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|289669143|ref|ZP_06490218.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 325

 Score =  305 bits (780), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 218/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHIA  D+ T  L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDQATGDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG+    A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGIVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGYDKHDLDWLIPHQANVRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|326316014|ref|YP_004233686.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323372850|gb|ADX45119.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 325

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 167/326 (51%), Positives = 213/326 (65%), Gaps = 14/326 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G SLP R L+N+DL +      V+TSD WI  R GI  RH A +D  ++ LG  
Sbjct: 5   SRITGTGSSLPPRRLTNADLVAELAGRGVETSDQWIVERTGIRARHFAERDVCSSDLGLE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A +   DIDLIIVATSTPD  FPSTA  +QN+LG     AFD+QAVCSGF+Y
Sbjct: 65  AARQALDAAGVQPADIDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFIY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+  ADS IRSG  RR +V+GS+ FSR++D++DR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALAVADSMIRSGGARRALVVGSEVFSRLLDFNDRTTCVLFGDGAGAVVLEASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V G       +G   ++M+G+AVFK AV    +    V D
Sbjct: 180 --GILASDLHADGRHVGILCVPGNVYGGEILGDPLLKMDGQAVFKLAVGVLDKAARAVLD 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L   ++DW +PHQAN RI+     K+ +P DKV+VTVD HGNTSAASIPLAL  AV+
Sbjct: 238 KAGLKESDVDWLIPHQANIRIMQGTARKLGLPMDKVVVTVDQHGNTSAASIPLALDHAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            G+ + G  LLLE +GGGFT G VLL
Sbjct: 298 TGQARPGQNLLLEGVGGGFTWGAVLL 323


>gi|322420575|ref|YP_004199798.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp. M18]
 gi|320126962|gb|ADW14522.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp. M18]
          Length = 326

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 221/332 (66%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR  + G G S+P +VL+N DLE +VDT+D WI  R GI  R IA + E T++    AA
Sbjct: 1   MIRPRITGTGSSVPEKVLTNFDLEKMVDTTDEWIVTRTGIRERRIAAEGEYTSTFATIAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +  ++IDLI+V T TPD  FP+TA  +Q  +     F FD+ A CSGF+YA+
Sbjct: 61  ERALEAAGVKAEEIDLIVVGTLTPDFPFPATACIVQQAIKATNAFCFDLSAACSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+ ++ SG V++ +VIG++  SRIVDW+DR+TC+LFGDGAGA++LE VE       ++
Sbjct: 121 ATAEKFMVSGQVKKALVIGAEVLSRIVDWNDRNTCLLFGDGAGAVVLEAVE------GES 174

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GILST++ SDG+Y D LY  G     P+T + +      + M+G  VFK AV    E+ +
Sbjct: 175 GILSTHMHSDGNYWDILYQKGAGSRNPATQKNLDDGLVYLTMQGNEVFKLAVRAMGEVAQ 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  ++  LT +++  F+PHQAN RI++S+  ++ I  ++V V +D +GNTSAASIP+AL 
Sbjct: 235 EALEANGLTADDVKLFIPHQANQRIVDSVGKRLGITGERVYVNLDRYGNTSAASIPIALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV+ GR+++GD LLL+A GGG T G+ L+RW
Sbjct: 295 EAVRAGRLEEGDILLLDAFGGGLTWGSALVRW 326


>gi|78046699|ref|YP_362874.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|123585692|sp|Q3BWI9|FABH_XANC5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|78035129|emb|CAJ22774.1| 3-oxoacyl-[acyl-carrier protein] synthase III [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 325

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 157/328 (47%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHI   D+TT+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIVADDQTTSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ ++IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTAEEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RIVDW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRIVDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLHADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALDSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++++P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGYDKHDLDWLIPHQANLRIIEATAKRLELPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFTWGSALLRY 325


>gi|312143445|ref|YP_003994891.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halanaerobium sp.
           'sapolanicus']
 gi|311904096|gb|ADQ14537.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halanaerobium sp.
           'sapolanicus']
          Length = 329

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 218/332 (65%), Gaps = 15/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M ++T+ G+G  LP +V++N DLE IVDT DGWIK R GI  R IA  DET + LG  AA
Sbjct: 1   MRKATITGLGKYLPEKVMTNKDLEKIVDTDDGWIKARTGIEERRIAADDETASDLGVKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
            +AL  A +  +++DLIIVAT TPD  FP+TA  IQ+R+G     AFD++A CSGFVY +
Sbjct: 61  EEALKKAGIKAEELDLIIVATITPDMPFPATACLIQDRIGASNAGAFDLEAACSGFVYGI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A S+I SG+   +MVIG++  S+I++W DR TC+LFGDGAGA +L+  + KG      
Sbjct: 121 SVASSFIESGMYDNIMVIGTEVLSKIINWEDRGTCILFGDGAGAAVLQPTD-KG------ 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GIL++ L SDGS  D LY+ GG    P+T  TV      + MEG  VFK+AV+   +   
Sbjct: 174 GILASDLGSDGSGGDTLYMPGGGSLKPATHETVDNKEHYLYMEGNQVFKFAVKIMSKASL 233

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           KV     L+ +++D  +PHQAN RII S   ++K+  ++V V +D +GNTSAAS+P+ALA
Sbjct: 234 KVLKKAGLSTDDVDLLIPHQANTRIIASSTKRLKLKPEQVFVNLDKYGNTSAASVPIALA 293

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A ++G +K GD ++L A GGG T  + +L W
Sbjct: 294 EAEEQGLIKNGDTIVLVAFGGGLTWASTVLEW 325


>gi|325143627|gb|EGC65946.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M01-240013]
          Length = 320

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 221/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A+++++DIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAKLNINDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SAADK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|160900704|ref|YP_001566286.1| 3-oxoacyl-(acyl carrier protein) synthase III [Delftia acidovorans
           SPH-1]
 gi|254783802|sp|A9BNK6|FABH_DELAS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|160366288|gb|ABX37901.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Delftia acidovorans
           SPH-1]
 gi|162659888|gb|EDQ48154.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|222838307|gb|EEE76672.1| predicted protein [Populus trichocarpa]
          Length = 325

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 211/325 (64%), Gaps = 14/325 (4%)

Query: 6   VRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           + G G  LP R L+N DL     +  ++TSD WI  R GI  RH A  D  ++ L   A+
Sbjct: 7   ITGTGSYLPPRRLTNHDLAAELAQRGIETSDEWIVERTGIHARHFAAPDVASSDLALEAS 66

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A     DIDLIIVATSTPD  FPSTA  +QN+LG     AFD+QAVCSGFVYA+
Sbjct: 67  KKALEAAGCQPQDIDLIIVATSTPDMVFPSTACILQNKLGANGCAAFDVQAVCSGFVYAL 126

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T AD+ I+SG   R +V+GS+ FSRI+D++DR+TCVLFGDGAGA++LE  E         
Sbjct: 127 TVADAMIQSGAASRALVVGSEVFSRILDFNDRTTCVLFGDGAGAVVLEASE-------QP 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL++ L +DG ++  L V G  S  + +G   ++M+G+AVFK AV    +      D  
Sbjct: 180 GILASDLHADGKHVGILCVPGNVSGGQVLGDPLLKMDGQAVFKLAVGVLEKAARATLDKA 239

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            LT  +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL   V+ G
Sbjct: 240 GLTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQHGNTSAASIPLALDHGVRNG 299

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           +VK G  +LLE +GGGFT G VLL+
Sbjct: 300 QVKPGQTVLLEGVGGGFTWGAVLLK 324


>gi|114320579|ref|YP_742262.1| 3-oxoacyl-(acyl carrier protein) synthase III [Alkalilimnicola
           ehrlichii MLHE-1]
 gi|122311740|sp|Q0A8R5|FABH_ALHEH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|114226973|gb|ABI56772.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 323

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 216/323 (66%), Gaps = 13/323 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  V++N DLE ++DTSD WI+ R GI+ R     D+T   L E AAR AL  A
Sbjct: 8   GTGSYLPDEVITNHDLERLIDTSDEWIRERTGITERRRVAPDQTCGDLAEEAARRALEAA 67

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSGFVYAVTTADSY 126
           ++S+  IDL+IV T TPD+ FPSTA  +Q RLGM+ G  AFD+ A CSGFVY +  AD +
Sbjct: 68  DVSLSSIDLVIVGTCTPDRVFPSTACLLQERLGMRHGSLAFDLSAACSGFVYGLGVADQF 127

Query: 127 IRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTY 186
            R+G VRR +VIG++T +RI+DW+DR+TCVLFGDGAGA++L+  E       + GILST+
Sbjct: 128 FRTGAVRRALVIGAETMTRILDWNDRATCVLFGDGAGAVVLDRSE-------EPGILSTH 180

Query: 187 LCSDGSYIDKLYVDGGPSTSRTV-----GCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           L SDG Y D L V  GP             I M+G  VFK AV     ++++   +  L 
Sbjct: 181 LHSDGRYQDLLGVPWGPGQGYEKRDALGPYITMQGNEVFKVAVRTLSRIVDESLAANGLE 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             +IDW VPHQAN RII +   K+++P ++V+VTVD  GNTSAASIP+AL  A+++GR+K
Sbjct: 241 KRDIDWLVPHQANIRIIQATARKLEMPMERVVVTVDKQGNTSAASIPMALDTAIRDGRIK 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +GD LLLEA GGGFT G+ L+R+
Sbjct: 301 RGDLLLLEAFGGGFTWGSALIRY 323


>gi|33597831|ref|NP_885474.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella
           parapertussis 12822]
 gi|46576486|sp|Q7W5I4|FABH_BORPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|33574260|emb|CAE38592.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Bordetella
           parapertussis]
          Length = 329

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 218/330 (66%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLES-----IVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  + + G G  LP RV++N DL +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 6   MKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRHLAERGVTTSQL 65

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AAR A+  A +  D+ID+IIVATSTPD  FPSTA  +Q  LG K G  FD+QAVCSG
Sbjct: 66  ATEAARRAMDDAGVQADEIDMIIVATSTPDYVFPSTACLVQANLGAKGGATFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+TTADS+IR+G  R  +VIG++ FSRI+DW+DR TCVLFGDGAGA++L+  +    
Sbjct: 126 FVYAMTTADSFIRAGRARCALVIGAEVFSRILDWNDRGTCVLFGDGAGAVVLKAAD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GIL+ +L +DGS    L   G  +     G   +RM+G+AVFK AV         
Sbjct: 182 ---EPGILAAHLHADGSQTKILCAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V     + +++IDW +PHQAN RI+N +  K+++P ++V++TVD H NTSAAS+PLAL V
Sbjct: 239 VCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITVDQHANTSAASVPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GRVK G  +L++ +GGGFT G+VL R
Sbjct: 299 ARRDGRVKPGQLVLMQGVGGGFTWGSVLAR 328


>gi|121595583|ref|YP_987479.1| 3-oxoacyl-(acyl carrier protein) synthase III [Acidovorax sp. JS42]
 gi|222111804|ref|YP_002554068.1| 3-oxoacyl-(acyl carrier protein) synthase iii [Acidovorax ebreus
           TPSY]
 gi|166971534|sp|A1WAX8|FABH_ACISJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|254783804|sp|B9MDQ9|FABH_DIAST RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120607663|gb|ABM43403.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Acidovorax sp. JS42]
 gi|221731248|gb|ACM34068.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidovorax ebreus
           TPSY]
          Length = 325

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 214/327 (65%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP   ++N DL     +  ++TSD WI  R GI  RH A +D T++ L   
Sbjct: 5   SRITGTGSYLPPHRVTNDDLVAQLAQQGIETSDEWIVERTGIRARHFADRDVTSSDLALE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           A+R AL  A     D+DLIIVATSTPD  FPSTA  +QN+LG     AFD+QAVCSGFVY
Sbjct: 65  ASRRALEAAGCQAQDLDLIIVATSTPDMVFPSTACILQNKLGANGCPAFDVQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ IRSG  RR +V+GS+ FSRI+D++DR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADAMIRSGGARRALVVGSEVFSRILDFNDRTTCVLFGDGAGAVVLEASEAP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DGS++  L V G     + +G   ++M+G+AVFK AV    +      D
Sbjct: 180 --GILASDLHADGSHVGILCVPGNVYGGQILGDPLLKMDGQAVFKLAVGVLEKAARATLD 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +T  +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL   V+
Sbjct: 238 KAGMTDADIDWLIPHQANIRIMQSTARKLKLSMDKVVVTVDQHGNTSAASIPLALDHGVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
            G+V+ G  +LLE +GGGFT G VLL+
Sbjct: 298 NGQVQPGQTVLLEGVGGGFTWGAVLLK 324


>gi|240122675|ref|ZP_04735631.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           gonorrhoeae PID332]
 gi|268681273|ref|ZP_06148135.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID332]
 gi|293397809|ref|ZP_06642015.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           F62]
 gi|268621557|gb|EEZ53957.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           PID332]
 gi|291611755|gb|EFF40824.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Neisseria gonorrhoeae
           F62]
          Length = 320

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 221/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A+++++DIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAKLNINDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDAGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|325133555|gb|EGC56218.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M13399]
          Length = 320

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 221/327 (67%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A+++++DIDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALADAKLNINDIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  ++IG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALIIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SAADK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|118594893|ref|ZP_01552240.1| 3-oxoacyl-(acyl carrier protein) synthase [Methylophilales
           bacterium HTCC2181]
 gi|118440671|gb|EAV47298.1| 3-oxoacyl-(acyl carrier protein) synthase [Methylophilales
           bacterium HTCC2181]
          Length = 317

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 214/324 (66%), Gaps = 7/324 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP+ +L+N DLES +DT+D WI  R GI  RHIAG DE T+ L   AA
Sbjct: 1   MNHAKIIGTGSYLPKTILTNKDLESRLDTTDEWIVSRTGIKERHIAGPDEKTSDLSYEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             A+  A +S  DIDLII+AT+TPD+ FPSTA  +Q RLG+K   AFD+QAVC+GFVYA+
Sbjct: 61  LGAIASANISPSDIDLIILATTTPDKIFPSTACTVQARLGIKECPAFDVQAVCTGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T A+ +I++   + V+VIG+D  S I D+ DRS  +L+GDGAGA+IL       S+  + 
Sbjct: 121 TIAEKFIKTNSAKNVLVIGADRMSSITDYDDRSNAILWGDGAGAVIL-------SASNEV 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+ST++ + G+Y + L+V      S     I M+G  VFK AV     ++++  +++ +
Sbjct: 174 GIISTHIHASGNYEELLHVPRHDKASHIADTIEMKGNQVFKIAVNTLDRIVDETLENSGI 233

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           T   IDW VPHQAN RI+ +   K+ +  DKVIVT+D HGNTSAASIPLAL   V+ G++
Sbjct: 234 TKSEIDWLVPHQANIRILEATAKKLDMSMDKVIVTIDRHGNTSAASIPLALDEGVRSGKI 293

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
            K   +L+EA GGGFT G+ L+++
Sbjct: 294 IKNQIILMEAFGGGFTWGSALVKY 317


>gi|33593427|ref|NP_881071.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella pertussis
           Tohama I]
 gi|46576477|sp|Q7VW29|FABH_BORPE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|33572783|emb|CAE42715.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Bordetella pertussis
           Tohama I]
 gi|332382836|gb|AEE67683.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella pertussis
           CS]
          Length = 328

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 219/330 (66%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLES-----IVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  + + G G  LP RV++N DL +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 5   MKYAKIAGSGGYLPERVVTNDDLAAELATRQISTSDEWIVERTGIRQRHLAERGVTTSQL 64

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AAR A+  A +  D+ID+IIVATSTPD  FPSTA  +Q  LG K G AFD+QAVCSG
Sbjct: 65  ATEAARRAMDDAGVQADEIDMIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSG 124

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+TTAD++IR+G  R  +VIG++ FSRI+DW+DR TCVLFGDGAGA++L+  +    
Sbjct: 125 FVYAMTTADNFIRAGRARCALVIGAEVFSRILDWNDRGTCVLFGDGAGAVVLKAAD---- 180

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GIL+ +L +DGS    L   G  +     G   +RM+G+AVFK AV         
Sbjct: 181 ---EPGILAAHLHADGSQTKILCAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 237

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V     + +++IDW +PHQAN RI+N +  K+++P ++V++T+D H NTSAAS+PLAL V
Sbjct: 238 VCAEAGVEVDDIDWLIPHQANVRILNFLARKLRVPTERVVITMDQHANTSAASVPLALDV 297

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GRVK G  +L++ +GGGFT G+VL R
Sbjct: 298 ARRDGRVKPGQLVLMQGVGGGFTWGSVLAR 327


>gi|58425095|gb|AAW74132.1| beta-ketoacyl- synthase III [Xanthomonas oryzae pv. oryzae
           KACC10331]
          Length = 356

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 217/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHIA  D+ T+ L   A+ 
Sbjct: 36  IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDQATSDLAYFASL 95

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 96  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 155

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RI+DW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 156 VADKFVRSGDAKTVLVVGAETLTRILDWTDRTTCVLFGDGAGAVILKADE-------ETG 208

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 209 ILSTHLRADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALNSVVDETLA 268

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 269 ANGYDAHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 328

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGF  G+ LLR+
Sbjct: 329 SGRVQRGQLLLLEAFGGGFAWGSALLRY 356


>gi|84622460|ref|YP_449832.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|161899014|ref|YP_199517.2| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas oryzae
           pv. oryzae KACC10331]
 gi|188578563|ref|YP_001915492.1| 3-oxoacyl-(acyl carrier protein) synthase III [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|123523084|sp|Q2P7B9|FABH_XANOM RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|84366400|dbj|BAE67558.1| beta-ketoacyl-[ACP] synthase III [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|188523015|gb|ACD60960.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 325

 Score =  302 bits (774), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 156/328 (47%), Positives = 217/328 (66%), Gaps = 12/328 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +VL+N D+  IVDTSD WI  R GI  RHIA  D+ T+ L   A+ 
Sbjct: 5   IYSRIAGTGSYLPEKVLTNDDMSKIVDTSDEWIFSRTGIRERHIAADDQATSDLAYFASL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A ++ D+IDLI++ T+TPD  FPSTA  +Q RLG     A D+ A CSGFVYA++
Sbjct: 65  KAMEAAGVTADEIDLIVIGTTTPDLIFPSTACLLQARLGNVGCGAMDVNAACSGFVYALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++RSG  + V+V+G++T +RI+DW+DR+TCVLFGDGAGA+IL+  E       +TG
Sbjct: 125 VADKFVRSGDAKTVLVVGAETLTRILDWTDRTTCVLFGDGAGAVILKADE-------ETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           ILST+L +DGS  + L+   G S          G + M+G  VFKYAV+    ++++   
Sbjct: 178 ILSTHLRADGSKKELLWDPVGVSVGFGEGKNGGGALLMKGNDVFKYAVKALNSVVDETLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +      ++DW +PHQAN RII +   ++ +P ++V+VTVD HGNTS+AS+PLAL  AV+
Sbjct: 238 ANGYDAHDLDWLIPHQANLRIIEATAKRLDLPMEQVVVTVDRHGNTSSASVPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV++G  LLLEA GGGF  G+ LLR+
Sbjct: 298 SGRVQRGQLLLLEAFGGGFAWGSALLRY 325


>gi|148244595|ref|YP_001219289.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus
           Vesicomyosocius okutanii HA]
 gi|166233406|sp|A5CWU7|FABH_VESOH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|146326422|dbj|BAF61565.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 314

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 153/317 (48%), Positives = 215/317 (67%), Gaps = 11/317 (3%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  V++N DL   ++T++ WI  R GI +RH    +ETT  L E AA  AL  A
Sbjct: 9   GTGSYLPPTVITNDDLSKTINTTNEWIVARTGIKQRHKV-TNETTCDLAEKAANRALEMA 67

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            ++V D+DLII+AT+T D+ FP+TA  +Q  +G     AFD+Q+VC+GF++A+TTA+ YI
Sbjct: 68  GINVKDLDLIILATTTADKIFPATATILQTAIGASCP-AFDLQSVCAGFIFALTTAEQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++    +V+V+GS+T SRIV+W+DRST VLFGDGAGA++L G +       +TGIL + L
Sbjct: 127 KASAANKVLVVGSETLSRIVNWNDRSTAVLFGDGAGAVVLSGSD-------NTGILYSKL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            SDG+Y+  L V    +    VG I M G  VFK AV +   L EK    T+L    +DW
Sbjct: 180 FSDGNYLSSLQVSN--NYINEVGFIEMSGNEVFKIAVNRLSSLAEKTLKETNLNSNKLDW 237

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
            VPHQAN RII+++  ++K P +KVIVT++ HGNTSAASIPLAL  AV++GR+K+GD LL
Sbjct: 238 IVPHQANIRIISAVAKRIKTPMNKVIVTLENHGNTSAASIPLALDTAVRDGRIKRGDHLL 297

Query: 308 LEAMGGGFTSGTVLLRW 324
            E +G GF+ G++L+++
Sbjct: 298 FEGIGAGFSWGSILIQF 314


>gi|260220739|emb|CBA28601.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 334

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 212/326 (65%), Gaps = 14/326 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  +P R L+N+DL +      V+TSD WI  R GI  RH       ++ LG  
Sbjct: 14  SRITGTGSYVPPRRLTNADLAAELAAQGVETSDEWIVERTGIRARHFVADGVYSSDLGLE 73

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           A ++AL  A +   DIDLIIVATSTPD  FPSTA  +QN+LG   G AFD+QAVCSGFVY
Sbjct: 74  ACKNALQSAGLQASDIDLIIVATSTPDMVFPSTACILQNKLGANGGAAFDVQAVCSGFVY 133

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ IR+G   + +V+G++ FSR++D++DR+TCVLFGDGAGA++LE  +       
Sbjct: 134 ALTVADALIRTGSANKALVVGAEVFSRLLDFTDRTTCVLFGDGAGAVVLEASDTP----- 188

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V G  S    +G   ++M+G+AVFK AV    +       
Sbjct: 189 --GILASDLHADGKHVGILCVPGHVSNGHILGDPLLKMDGQAVFKLAVGVLEDAARATLA 246

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T  +IDW +PHQAN RI+ S   K+K+P DKV+VTVD HGNTSAASIPLAL  AV+
Sbjct: 247 KAGKTEADIDWLIPHQANIRIMQSTAKKLKLPMDKVVVTVDQHGNTSAASIPLALDSAVR 306

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            GRV+ G  L+LE +GGGFT G VLL
Sbjct: 307 AGRVQPGQNLMLEGVGGGFTWGAVLL 332


>gi|197119479|ref|YP_002139906.1| 3-oxoacyl-(acyl carrier protein) synthase III [Geobacter
           bemidjiensis Bem]
 gi|197088839|gb|ACH40110.1| 3-oxoacyl-(acyl carrier protein) synthase III [Geobacter
           bemidjiensis Bem]
          Length = 326

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 152/332 (45%), Positives = 222/332 (66%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR  + G G ++P++VL+N D+E +VDTSD WI  R GI  R IA + E T++    AA
Sbjct: 1   MIRPKITGTGSAVPQKVLTNFDIEKMVDTSDEWIVSRTGIRERRIASEGEFTSTFAALAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A ++ +++DLI+V T TPD  FP+TA  +Q  +     F FD+ A CSGF+YA+
Sbjct: 61  QRALEAAGVAPEELDLIVVGTLTPDFPFPATACIVQQIIKAPNAFCFDLSAACSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA+ YI SG V++ +VIG++  SRIVDW+DR+TC+LFGDG+GA++LE VE       ++
Sbjct: 121 ATAEKYILSGKVKKALVIGAEVLSRIVDWTDRNTCLLFGDGSGAVVLEAVE------GES 174

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GILST++ SDG+Y + LY  G     P+T + +      + M+G  VFK AV    E+ +
Sbjct: 175 GILSTHMHSDGNYWEILYQKGAGSRNPATQKNLDDRLVYLTMQGNEVFKLAVRAMGEVAQ 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   +  LT +++  F+PHQAN RI++SI  ++ I  ++V V +D +GNTSAASIP+AL 
Sbjct: 235 EALAANGLTPDDVSLFIPHQANQRIVDSIGKRLGITGERVFVNLDRYGNTSAASIPIALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV+ GR+K+GD LL++A GGG T G  L+RW
Sbjct: 295 EAVRAGRLKEGDILLIDAFGGGLTWGASLIRW 326


>gi|332284948|ref|YP_004416859.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pusillimonas sp.
           T7-7]
 gi|330428901|gb|AEC20235.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pusillimonas sp.
           T7-7]
          Length = 324

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 220/330 (66%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLES-----IVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  + + G G  LP R++SN +L +      ++TSD WI  R GI +RHIA    TT+ L
Sbjct: 1   MPYAKIIGSGAYLPPRIVSNDELAADLATRNIETSDTWIVERTGIRQRHIADPGVTTSQL 60

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AA+ AL +A ++  D+DLIIVATSTPD  FPSTA  +Q  LG K G AFD+QAVCSG
Sbjct: 61  ATKAAQAALENAGVAAADLDLIIVATSTPDFVFPSTACLVQANLGSKGGAAFDVQAVCSG 120

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+ TAD++I++G  +  MVIG++ FS I+DW+DRSTCVLFGDGAGA++L+  +    
Sbjct: 121 FVYALATADAFIQAGRAKTAMVIGAEVFSSILDWNDRSTCVLFGDGAGAVVLKASD---- 176

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GI++  L +DGS +  L   G  +  + VG   +RM+G+AVFK AV    +    
Sbjct: 177 ---EPGIMAAQLNADGSQMKILCAAGNVAHGKVVGDPFLRMDGQAVFKLAVTSLTKSALD 233

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V +   +  E+IDW VPHQAN RIIN +  ++ I  DKV++TVD H NTSAAS+PLA   
Sbjct: 234 VCEQAGVRFEDIDWLVPHQANVRIINFLGRRLNIADDKVVITVDSHANTSAASVPLAFDA 293

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GR+K GD +L++ +GGGFT G+VL+R
Sbjct: 294 ARRDGRIKTGDTVLMQGVGGGFTWGSVLVR 323


>gi|319787598|ref|YP_004147073.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317466110|gb|ADV27842.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 326

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 154/329 (46%), Positives = 222/329 (67%), Gaps = 13/329 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I S + G G  LP +V++N DL  +VDTSD WI+ R GI  R +A + + T+ L   AA 
Sbjct: 5   IYSRIAGTGSYLPEKVVTNDDLAKVVDTSDEWIRTRTGIRERRVAAEGQATSDLAYEAAL 64

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A +S D+IDLI+V T+TPD  FPS A  +Q +LG+    AFD+ A CSGFV+A++
Sbjct: 65  RAIEAAGISPDEIDLIVVGTTTPDVIFPSAACLVQQKLGIAGCPAFDVNAACSGFVFALS 124

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++++G  R  +VIG++T +RIVDW+DR+TCVLFGDGAGA++L+       + ++TG
Sbjct: 125 VADKFVQTGAARTALVIGAETLTRIVDWNDRTTCVLFGDGAGAVVLK-------ADSETG 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPST-----SRTVGC-IRMEGKAVFKYAVEKAVELIEKVF 235
           ILST+L +DGS  + L+   G S+     +   G  I M G  VFK+AV+    ++++  
Sbjct: 178 ILSTHLHADGSKRELLHCPAGVSSGFDKDATNAGVRILMSGNEVFKHAVKALDGVVDETL 237

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           ++  L   ++DW +PHQAN RII +   ++++  D+V+VTVD HGNTSAAS+PLAL  AV
Sbjct: 238 EANGLGKGDLDWLIPHQANLRIIEATAKRLEMSMDRVVVTVDRHGNTSAASVPLALDEAV 297

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + GRV++G  LLLEA GGGFT G+ LLR+
Sbjct: 298 RSGRVQRGQLLLLEAFGGGFTWGSALLRY 326


>gi|15606369|ref|NP_213748.1| 3-oxoacyl-(acyl carrier protein) synthase III [Aquifex aeolicus
           VF5]
 gi|9910682|sp|O67185|FABH_AQUAE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157834882|pdb|2EBD|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
           Synthase Iii From Aquifex Aeolicus Vf5
 gi|157834883|pdb|2EBD|B Chain B, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein]
           Synthase Iii From Aquifex Aeolicus Vf5
 gi|2983572|gb|AAC07144.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Aquifex aeolicus
           VF5]
          Length = 309

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 154/317 (48%), Positives = 212/317 (66%), Gaps = 14/317 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G+ LP+ VL+N DLE IVDTSD WI  R GI  R IA K+ET   +   AA++AL  A
Sbjct: 7   GTGVYLPKNVLTNFDLEKIVDTSDEWITTRTGIKERRIA-KEETITYMATQAAKEALREA 65

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +S +++DLII+AT TP + FPSTA  +Q +L  K  +AFD+ A CSGF+YA+  ADS+I
Sbjct: 66  NLSPEELDLIILATLTPQKRFPSTACLVQAQLKAKGVYAFDISAACSGFIYALDIADSFI 125

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG  + V+VIG++  S  VDW DRSTCVLFGDGAGA+++   E K      + IL+T +
Sbjct: 126 KSGKAKNVLVIGAEKLSEAVDWEDRSTCVLFGDGAGAVVVTRSEDK------SDILATRM 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            ++GS  + L+ D         G IRM+G+ +FK AV    E+  +V +   +  E +  
Sbjct: 180 YAEGSLEELLHAD-------NCGYIRMKGRELFKVAVRSMEEVCREVLEKAGVKPEEVSL 232

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
            +PHQAN RIIN++ +K+ IP +KV V +  +GNTSAASIP+AL  A+KEG+VK+GD +L
Sbjct: 233 VIPHQANVRIINALAEKLNIPKEKVFVNIQKYGNTSAASIPIALHEAIKEGKVKRGDLIL 292

Query: 308 LEAMGGGFTSGTVLLRW 324
           + AMGGG T G VLLR+
Sbjct: 293 MTAMGGGLTWGAVLLRY 309


>gi|261400594|ref|ZP_05986719.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria lactamica
           ATCC 23970]
 gi|269209673|gb|EEZ76128.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria lactamica
           ATCC 23970]
          Length = 320

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 219/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ ++IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLNGNEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y++ L   G  +  +  G   ++M+G  VFK+AV+   ++ ++V   
Sbjct: 174 PGIIHGKLKADGNYLNLLNAPGKIADGQICGSPYVKMDGPGVFKFAVKMLAKIADEVISE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T E IDW VPHQAN RII S    + +  DKVI+TV  HGNTSAASIPLAL   +  
Sbjct: 234 AGYTAEQIDWIVPHQANRRIIESTAKHLNLSMDKVILTVQDHGNTSAASIPLALDAGISN 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|294788045|ref|ZP_06753289.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Simonsiella muelleri
           ATCC 29453]
 gi|294484338|gb|EFG32021.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Simonsiella muelleri
           ATCC 29453]
          Length = 319

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 158/326 (48%), Positives = 217/326 (66%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP+  +SN DL   +DTSD WI  R GI  RHIA  +E T+ L  AAA
Sbjct: 1   MKYSKILGTGSYLPQNRVSNDDLAQRIDTSDEWITTRTGIKARHIASDNEKTSDLATAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A +S D+IDLIIVAT+TPD  FPSTA  +Q +LG+    AFD+QAVC+GF+YA+
Sbjct: 61  RQAIEAAAISADEIDLIIVATTTPDMQFPSTATMVQQKLGISGCPAFDVQAVCAGFMYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA++YI+SG+  + +VIG+D FSRI++W DR TCVLFGDGAGA++L   +       D 
Sbjct: 121 ATANAYIQSGMATKALVIGADIFSRILNWEDRGTCVLFGDGAGAVVLGASD-------DV 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+S+ L +DG Y+D L V       +  G   + M+G+ VFK+AV++   + ++V +  
Sbjct: 174 GIISSRLHADGHYLDLLKVPAQMIDGQICGSPFVEMDGQGVFKFAVKQLAAVAQEVLEMA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             T + +DW +PHQAN RII S    + +  DKVI+TV  H NTSAASIPLAL   V++G
Sbjct: 234 DYTADQVDWMIPHQANRRIIESTAKHLGLSMDKVILTVAEHANTSAASIPLALDAGVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+++G  LLLE +GGGF  G VL+++
Sbjct: 294 RIQRGQILLLEGIGGGFAWGAVLIQY 319


>gi|329118067|ref|ZP_08246779.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327465727|gb|EGF12000.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 319

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/326 (50%), Positives = 222/326 (68%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP + LSN+DL   VDTSD WI  R GI  RHIA + E T+ L  AAA
Sbjct: 1   MKYAKILGTGSYLPEKRLSNNDLAEFVDTSDEWITTRTGIKFRHIAAEHEKTSDLAVAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +S  +I LIIVAT+TPD  FP+TA  +Q++LG+    AFD+QAVC+GF+YA+
Sbjct: 61  RRALDDAGVSAAEIGLIIVATATPDMQFPATATIVQHKLGIAGCPAFDVQAVCAGFMYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           +TA++YIRSG+  +V+VIG++TFSRI+DW DR+TCVLFGDGAGA++L      G+S  + 
Sbjct: 121 STANAYIRSGMADKVLVIGAETFSRILDWRDRTTCVLFGDGAGAVVL------GAS-DEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+ + L +DG Y+D L V    +  +  G   I M+G  VFK+AV+  V++ E V    
Sbjct: 174 GIIGSRLQADGGYLDLLKVPAQMADGKICGNPYIEMDGPGVFKFAVKMLVKVAEDVLAEA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
               + IDW VPHQAN RII+S    + +P +KVI+TV  HGNTSAASIPLAL   ++ G
Sbjct: 234 GYAADQIDWIVPHQANKRIIDSTAKHLGLPAEKVILTVQDHGNTSAASIPLALDAGIRRG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 QIKRGQTLLLEGIGGGFAWGAVLLKY 319


>gi|291613994|ref|YP_003524151.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sideroxydans
           lithotrophicus ES-1]
 gi|291584106|gb|ADE11764.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sideroxydans
           lithotrophicus ES-1]
          Length = 309

 Score =  300 bits (769), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 217/325 (66%), Gaps = 17/325 (5%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP +VL+N DLE IVDTS  WI  R GI  RH A  DE T+ L   A+
Sbjct: 1   MTYSRIIGTGSYLPAKVLTNYDLEKIVDTSHDWIFTRSGIVERHFAADDELTSDLALQAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSGFVYA 119
           R A+  A +  D+IDLIIVAT++PD  FPSTA  +Q++LG++ G  AFDMQAVC GFVYA
Sbjct: 61  RKAIEAAGIQADEIDLIIVATTSPDMAFPSTACILQDKLGIRNGGAAFDMQAVCGGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           + TAD YIR G  + V+V+G++  SR++DW+DR+TCVLFGDGAGA++L   +        
Sbjct: 121 LNTADLYIRGGQAKTVLVVGAEVLSRMLDWNDRTTCVLFGDGAGAVVLRASD-------K 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            G+++  L +DG +   L  D  P  S       M+GKAVFK+AV+   E++E+V +   
Sbjct: 174 PGVVTAKLHADGIHRGMLKAD--PKVS-------MDGKAVFKFAVKVLSEVVEEVLEERK 224

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +   +IDW VPHQAN RII +   K+ +  D V++TVD HGNTSAASIPLAL  AV++GR
Sbjct: 225 MAGTDIDWLVPHQANIRIIEATAKKLGLEMDSVVLTVDKHGNTSAASIPLALDTAVRDGR 284

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +K G  +LLEA+GGGFT G VL+ W
Sbjct: 285 IKPGQNILLEAVGGGFTWGAVLINW 309


>gi|217970729|ref|YP_002355963.1| 3-oxoacyl-(acyl carrier protein) synthase III [Thauera sp. MZ1T]
 gi|217508056|gb|ACK55067.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thauera sp. MZ1T]
          Length = 321

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 220/326 (67%), Gaps = 11/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDL-ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAA 59
           MI + + G G  LP   +SN DL +  +DTSD WI  R GI  RH+A  D   + L   A
Sbjct: 1   MIYARIAGTGSYLPGEPVSNDDLVKRGIDTSDEWIVSRSGIRSRHLAAADTGASDLARVA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSGFVY 118
           A  A+  A    +DIDLIIVATSTPD  FPSTA  +Q++LG++ G  AFD+QAVCSGF+Y
Sbjct: 61  AERAIEAAGCEAEDIDLIIVATSTPDYIFPSTAALVQSKLGIRNGGAAFDVQAVCSGFIY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ A+ +IRSG  +R +VIG++ FSRI+DWSDR TCVLFGDGAGA++LE  E       
Sbjct: 121 ALSVAEKFIRSGSNKRALVIGAEVFSRILDWSDRGTCVLFGDGAGAVVLEASE------- 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DGS+   L V G  ++ + +G   +RM+G+AVFK+AV+   ++  +V D
Sbjct: 174 RPGILASALHADGSHHPILCVPGAVASGQVIGDPFLRMDGQAVFKFAVKVLGDVANEVLD 233

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  +   ++DW +PHQAN RII +   ++ +P ++V+ T+D HGNTSAASIPLAL  AV+
Sbjct: 234 AAGVQASSVDWLIPHQANIRIIQATAKRLGVPMERVVTTLDHHGNTSAASIPLALDEAVR 293

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            GR++ G  +++E +GGGFT G  L+
Sbjct: 294 AGRLRPGHRIVVEGVGGGFTWGAALI 319


>gi|319943495|ref|ZP_08017777.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Lautropia mirabilis
           ATCC 51599]
 gi|319743310|gb|EFV95715.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Lautropia mirabilis
           ATCC 51599]
          Length = 347

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 222/327 (67%), Gaps = 16/327 (4%)

Query: 6   VRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           V G+G +LP R ++N DL +      V+TSD WI  R GI +R +AG D+TT SLG  AA
Sbjct: 29  VIGVGSALPARRVTNDDLVADLAARGVETSDEWISTRTGIRQRWLAGPDDTTTSLGARAA 88

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A +  DDIDL++ ATSTPDQ FPSTA  IQN LG+ +G AFD+QAVCSGFVYA+
Sbjct: 89  RAAMEMAGVGPDDIDLVVCATSTPDQIFPSTACLIQNELGIHQGGAFDVQAVCSGFVYAM 148

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD+ IR+GV +R +VIG+D FSRI+DW+DRSTCVLFGDGAGA++L        S +DT
Sbjct: 149 ANADALIRAGVAKRALVIGADVFSRIMDWNDRSTCVLFGDGAGAVLL--------SASDT 200

Query: 181 -GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDS 237
            G+L + L +DG     L   G        G   +RM+G+AVFK AV    +L ++   +
Sbjct: 201 PGVLVSRLHADGRQSGILSTPGSVRGGAVCGHPFLRMDGQAVFKLAVRVLADLAQETLQA 260

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             L+++++DW VPHQAN RI+++   ++ +P DKV+ TV  H NTSAAS+PLAL  AVK+
Sbjct: 261 ADLSVDDLDWLVPHQANIRILSATASRLGLPEDKVVSTVAEHANTSAASVPLALTQAVKD 320

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+K G  +L+E +GGGFT    L+R+
Sbjct: 321 GRIKPGHLVLMEGVGGGFTWAANLIRF 347


>gi|313669137|ref|YP_004049421.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria lactamica
           ST-640]
 gi|313006599|emb|CBN88064.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           lactamica 020-06]
          Length = 320

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++  +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLNGSEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +V+G++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVVGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLAKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T E IDW VPHQAN RII S    + +  DKVI+TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVILTVQDHGNTSAASIPLALDAGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VL+ +
Sbjct: 293 NGQIKRGQNLLLEGIGGGFAWGAVLMEY 320


>gi|121998025|ref|YP_001002812.1| 3-oxoacyl-(acyl carrier protein) synthase III [Halorhodospira
           halophila SL1]
 gi|121589430|gb|ABM62010.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Halorhodospira
           halophila SL1]
          Length = 323

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 212/330 (64%), Gaps = 13/330 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP RV++N DLE  V+TSD WI+ R GI  R + G+DE    LG  AA
Sbjct: 1   MRNARIIGTGSYLPERVVTNQDLEQHVETSDQWIRERTGICERRVIGEDEVCGDLGRIAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAV-CSGFVYA 119
           + AL  A +S D+IDLIIVAT TPD+ FPSTA ++Q  LG++ G A    A  CSGF+YA
Sbjct: 61  QRALEAAGVSGDEIDLIIVATCTPDRIFPSTASSLQRALGVRPGAAAFDIAAACSGFIYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +  A+ ++R G  +R +V+G++  +RI++W DR TCVLFGDG GA++LE  E       +
Sbjct: 121 LGIAERFVRFGDAQRALVVGAEAMTRILNWDDRGTCVLFGDGGGAVVLEASE-------E 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTV-----GCIRMEGKAVFKYAVEKAVELIEKV 234
            G+LST+L  DG Y   LYV  GP           G I M G  VFK AV     ++E+ 
Sbjct: 174 PGVLSTHLHCDGRYEPLLYVPWGPGRGYAALGAESGYIHMRGNEVFKVAVNTLTRIVEET 233

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
            D+  +    +DW VPHQAN RII +   K+ +P ++V+VTV  HGNTSAASIP+AL  A
Sbjct: 234 LDAAGVDKGEVDWLVPHQANIRIIQATAKKLDLPMERVVVTVGEHGNTSAASIPIALDTA 293

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++GR+++G+ LLLEA GGGFT G+ L+R+
Sbjct: 294 VRDGRIQRGETLLLEAFGGGFTWGSALVRY 323


>gi|296313953|ref|ZP_06863894.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           polysaccharea ATCC 43768]
 gi|296839497|gb|EFH23435.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           polysaccharea ATCC 43768]
          Length = 320

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 219/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ ++IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLNGNEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+  +
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDE 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHAKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKVI+TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVILTVQDHGNTSAASIPLALDAGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|225024138|ref|ZP_03713330.1| hypothetical protein EIKCOROL_01006 [Eikenella corrodens ATCC
           23834]
 gi|224943163|gb|EEG24372.1| hypothetical protein EIKCOROL_01006 [Eikenella corrodens ATCC
           23834]
          Length = 319

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 218/326 (66%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP + LSN DL  IVDTSD WI  R GI  RHIA  +E  + L  AAA
Sbjct: 1   MTYAKILGTGSYLPAKTLSNHDLAKIVDTSDEWITTRTGIKTRHIAADNEKCSDLAVAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           ++AL  A +   +IDLI+VATSTPD  FP+TA  +Q +LG+    AFD+QAVC+GF+YA+
Sbjct: 61  QNALEAAGVDAAEIDLIVVATSTPDMQFPATATIVQQKLGISGCPAFDVQAVCAGFMYAI 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTA++YI+SG+ ++ +VIG+D FSRI+DW+DR TCVLFGDGAGA++L   +       + 
Sbjct: 121 TTANAYIKSGMAKKALVIGADVFSRIMDWTDRRTCVLFGDGAGAVVLGASD-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL + L +DG+Y   L   G  +     G   ++M+G  VFK+AV+   ++ E V    
Sbjct: 174 GILHSKLLADGNYGYLLQTPGQIANGAVCGTPFLQMDGPGVFKFAVKALAKVAEDVIAEA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            LT + +DW VPHQAN+RI+ S    +K+  +KV++TV  HGNTSAASIPLAL   V++G
Sbjct: 234 GLTPDQVDWLVPHQANYRILESTAKHLKLGMEKVVLTVQDHGNTSAASIPLALDWGVRQG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
            +++G  LLLE +GGGF  G VL+++
Sbjct: 294 SIQRGHTLLLEGIGGGFAWGAVLVKY 319


>gi|296535302|ref|ZP_06897507.1| beta-ketoacyl-acyl-carrier-protein synthase I [Roseomonas
           cervicalis ATCC 49957]
 gi|296264353|gb|EFH10773.1| beta-ketoacyl-acyl-carrier-protein synthase I [Roseomonas
           cervicalis ATCC 49957]
          Length = 316

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 215/324 (66%), Gaps = 13/324 (4%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESI--VDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           R+ + G G  LP  VL N  L +   +DTSD WI+ R GI +RH+A   E  + +G AAA
Sbjct: 4   RALIAGTGGYLPALVLDNDSLAARHGLDTSDAWIRERTGIRQRHLAAPGEKASDMGAAAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +    +D IIVAT+TPD  FPSTA  +Q  LG+ RGFAFD+ A C+GFVYA+
Sbjct: 64  RAALEQAGLDTSAVDGIIVATATPDAPFPSTAARVQALLGVSRGFAFDLAAACTGFVYAL 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+ IR+G  R V+VIG++ FSRI+DW+DR TCVLFGDGAGA++L   E    S A  
Sbjct: 124 SVADAMIRAGQARCVLVIGAEVFSRILDWTDRGTCVLFGDGAGAVVLRAAE---ESEAGR 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           G+LS +L +DG + D L V+G        G +RM G+ VF++AV K   ++++   +  L
Sbjct: 181 GVLSCHLHADGRHGDILQVEG--------GLLRMAGREVFRHAVSKLASVVDEALAANGL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++ W VPHQAN RII+++  K+ +P ++V+V VD H NTSAASIPLALA A ++GR+
Sbjct: 233 AKSDVAWLVPHQANQRIIDAMGRKLGLPPERVVVAVDRHANTSAASIPLALAEATRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
            +GD +L+E +GGG T G  L R+
Sbjct: 293 ARGDLVLMEGIGGGLTWGAALARF 316


>gi|187924888|ref|YP_001896530.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           phytofirmans PsJN]
 gi|187716082|gb|ACD17306.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           phytofirmans PsJN]
          Length = 329

 Score =  299 bits (766), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 224/335 (66%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     +  V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPNRVTNQDLAERLGKQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
             A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVCSG
Sbjct: 66  LIASQRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV TADS+IRSG  R  +VIG++TFSRI+D++DR+TCVLFGDGAGA+IL+  E    
Sbjct: 126 FAYAVATADSFIRSGQHRTALVIGAETFSRILDFNDRTTCVLFGDGAGAVILQASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
                G+L++ L +DGS+ + L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 182 ---QPGVLASALHADGSHSNILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ E IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSAEQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A  VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 AFDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|218767510|ref|YP_002342022.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           meningitidis Z2491]
 gi|34098726|sp|Q9JW56|FABH_NEIMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|121051518|emb|CAM07815.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           meningitidis Z2491]
          Length = 320

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 221/328 (67%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++ ++IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLNGNEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VLL++
Sbjct: 293 SGQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|309379524|emb|CBX21890.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 320

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 220/328 (67%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A ++  +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLNGSEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T   IDW VPHQAN RII S    + +  DKVI+TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVILTVQDHGNTSAASIPLALDAGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VLL++
Sbjct: 293 NGQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|88606851|ref|YP_504929.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Anaplasma
           phagocytophilum HZ]
 gi|88597914|gb|ABD43384.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Anaplasma
           phagocytophilum HZ]
          Length = 319

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 217/322 (67%), Gaps = 4/322 (1%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +++ + G+G  LP + ++N DL  IVDT+D WI RR GI RR++  + E T+ +   AA 
Sbjct: 1   MKAVLCGVGSFLPHKAVTNEDLSLIVDTTDEWIFRRTGIKRRYLVSEGEATSDMAVKAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S +++DLI+VATSTPD T PS A  +Q +LG  + FAFDM A CSGFVYA++
Sbjct: 61  AALSDAGVSAEEVDLIVVATSTPDSTLPSCATMVQGKLGCTKAFAFDMNAACSGFVYAIS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
             DS I++G V   ++IG+++ S+IVDW DRSTCVLFGDGAGA + +G        ++ G
Sbjct: 121 VVDSLIKTGQVGVALLIGAESMSKIVDWHDRSTCVLFGDGAGACVFKG----DGKASNRG 176

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ T L +DG+  D LY DGG +++ T G IRM+G  +F++A+ K    +E +     + 
Sbjct: 177 IVDTALYTDGTLGDILYTDGGVASTCTAGHIRMKGTVLFEHAILKLSSSVEGLLKKNAIG 236

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
           I+ IDWF+PHQAN RI++ +  ++ I  DKV++ +  H NTSAASIPLA++ A ++G+++
Sbjct: 237 IDAIDWFIPHQANVRIVDLVAKRLGISQDKVVLGIGDHANTSAASIPLAMSDARRDGKLQ 296

Query: 302 KGDCLLLEAMGGGFTSGTVLLR 323
           +G  +LL A+G G T G  L+R
Sbjct: 297 EGQLVLLAAIGAGVTWGASLIR 318


>gi|319792212|ref|YP_004153852.1| 3-oxoacyL-(acyL-carrier-protein) synthase iii [Variovorax paradoxus
           EPS]
 gi|315594675|gb|ADU35741.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Variovorax paradoxus
           EPS]
          Length = 325

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 163/327 (49%), Positives = 212/327 (64%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R ++N +L        ++TSD WI  R GI  RH A  D  ++ LG  
Sbjct: 5   SRITGTGSYLPPRRVTNDNLAKELASRGIETSDQWIVERTGIHARHFAAPDVGSSDLGLE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AA+ AL  A     D+DLIIVATSTPD  FPS+A  +QN+LG+    AFD+QAVCSGFVY
Sbjct: 65  AAKHALEAAGRKASDVDLIIVATSTPDMVFPSSAAILQNKLGIAGCPAFDVQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           AVT AD+ IR+G  R  +VIG++ FSRI+D++DR+TCVLFGDGAGA++LE  +       
Sbjct: 125 AVTVADAMIRTGTARCALVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLEASD------- 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           + GILS+ L +DG ++  L V G  S    +G   + M+G+AVFK AV    E       
Sbjct: 178 EPGILSSDLHADGKHVGILCVPGHVSGGNVLGTPLLHMDGQAVFKLAVRVLEEAARTALA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T  +IDW +PHQAN RI+     K+K+P +K+IVTV+ HGNTSAASIPLAL  AV+
Sbjct: 238 KAGKTEADIDWLIPHQANIRIMEGTAKKLKLPREKLIVTVNEHGNTSAASIPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
            G+VKKG+ L+LE +GGGFT G VLL 
Sbjct: 298 SGKVKKGETLMLEGVGGGFTWGAVLLN 324


>gi|256822410|ref|YP_003146373.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Kangiella koreensis
           DSM 16069]
 gi|256795949|gb|ACV26605.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Kangiella koreensis
           DSM 16069]
          Length = 320

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 146/332 (43%), Positives = 217/332 (65%), Gaps = 20/332 (6%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G+G  LP +VL+N+DLE +VDT+D WI  R GI +RHIA  D++ + LG  AA
Sbjct: 1   MKYSKILGMGSYLPEKVLTNADLEKMVDTTDAWITERTGIKKRHIAADDQSASDLGFEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+ ++ +   DID+I+V T+TPD+ FPS A  I + LG+    AFD+   C GFVY +
Sbjct: 61  KKAIANSGLEAKDIDMIVVGTATPDKMFPSVACYIGHALGIGGVPAFDITTACPGFVYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +I++G  + V+V+G++  SR+V+W DRSTCV+FGDGAGA ++ G +       + 
Sbjct: 121 SIADQFIKTGHRKNVLVVGTEVLSRLVNWDDRSTCVIFGDGAGAAVVTGSD-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG--------PSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
           GILST++ +DG Y D LY + G        P        I M G  VFK AV+   ++++
Sbjct: 174 GILSTHIHADGGYGDLLYCNNGLRGQLGEFPEPQ-----IVMRGNEVFKVAVKTLSQIVD 228

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   + ++  ++IDW +PHQAN RII +   K+    DKV+V VD HGNTS+ASIPLA+ 
Sbjct: 229 ETLAANNMQKKDIDWLIPHQANIRIIQATAKKLGASMDKVVVAVDRHGNTSSASIPLAMC 288

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A+++GR+K+GD  LLE+ GGGFT G+ L+++
Sbjct: 289 EAIEDGRIKRGDVCLLESFGGGFTWGSALIKY 320


>gi|319779251|ref|YP_004130164.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Taylorella
           equigenitalis MCE9]
 gi|317109275|gb|ADU92021.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Taylorella
           equigenitalis MCE9]
          Length = 324

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 219/331 (66%), Gaps = 14/331 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M+ S + G G +LP   +SN DL     +  ++TSD WI  R GIS+R+IA   ETT++L
Sbjct: 1   MVYSKILGSGSALPELKVSNDDLAKKLAQKGIETSDEWINSRTGISQRYIASDSETTSTL 60

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AA+ A+ +A ++ DDIDLI++ TSTPD  FPSTA  IQ  LG++ G AFD+QAVCSG
Sbjct: 61  ATKAAKLAMENAGVTADDIDLIVLGTSTPDHIFPSTACLIQANLGVENGAAFDVQAVCSG 120

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F+YA+T AD +I+S   +  +VIG+DT ++I+DW+DR TCVLFGDGAGA++L   E    
Sbjct: 121 FLYALTVADKFIKSNASKMALVIGADTLTKILDWNDRRTCVLFGDGAGAVVLGASE---- 176

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GI++T + S GS    L   G     + VG   +RM+G+AVFK AV K  +   +
Sbjct: 177 ---EAGIIATQINSMGSLNGILNTPGNIRHGQIVGDPFLRMDGQAVFKQAVTKLEKSALE 233

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V +   ++   IDWF+PHQAN RII+S+  K+ +P ++VI+TV  H NTSAAS+PLAL  
Sbjct: 234 VCEMAGISTSEIDWFIPHQANARIISSLARKLDLPEERVIMTVSEHANTSAASVPLALDY 293

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A K G +K G   +L+ +GGGFT G+ L+R+
Sbjct: 294 AFKNGLIKSGHLAMLQGVGGGFTWGSALVRF 324


>gi|148263932|ref|YP_001230638.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter
           uraniireducens Rf4]
 gi|146397432|gb|ABQ26065.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Geobacter
           uraniireducens Rf4]
          Length = 326

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 217/332 (65%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+R+ + G G ++P +VL+N DLE +VDTSD WI  R GI  R IAG+ E T++    AA
Sbjct: 1   MMRARITGTGSAVPDKVLTNFDLEKMVDTSDEWITTRTGIKERRIAGEGEYTSTFATRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +  D++DL+IV T TPD  FP+TA  +QN +      AFD+ A CSGF+Y +
Sbjct: 61  EKALEMAGVKADELDLVIVGTVTPDFPFPATACVVQNNIKAVNAAAFDVTAACSGFLYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A+ +IR+G V++ +VIG++  SRI+DWSDR+TC+LFGDGAGA+++E  E       D 
Sbjct: 121 SVAEKFIRTGTVKKALVIGAEVLSRIIDWSDRNTCLLFGDGAGAVVVEACE------GDN 174

Query: 181 GILSTYLCSDGSYIDKLYVDG----GPSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           G+LST++ SDGS+ + LY+       P+T + V      + M+G  VFK AV    E+  
Sbjct: 175 GVLSTHIHSDGSFWELLYLPACGSRNPATQKAVDDKLIYLMMQGNEVFKLAVRAMGEVAH 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   ++ +T  +ID F+PHQAN RII++I  ++ +  D+V V +D +GNTSAASIP+AL 
Sbjct: 235 EALAASGMTPADIDLFIPHQANRRIIDAIGKRLGLAEDRVFVNLDRYGNTSAASIPIALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A +  R+K+GD +L +A GGG T G  LLRW
Sbjct: 295 EANRSSRIKEGDIVLFDAFGGGLTWGAALLRW 326


>gi|239814396|ref|YP_002943306.1| 3-oxoacyl-(acyl carrier protein) synthase III [Variovorax paradoxus
           S110]
 gi|259646346|sp|C5CSE2|FABH_VARPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|239800973|gb|ACS18040.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Variovorax paradoxus
           S110]
          Length = 325

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 213/326 (65%), Gaps = 14/326 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R ++N DL        ++TSD WI  R GI  RH A  + T++ L   
Sbjct: 5   SRITGTGSYLPPRRVTNDDLAKELATRGIETSDQWIVERTGIHARHFAAPEVTSSDLALE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A    +DIDLIIVATSTPD  FPS+A  +QN+LG+    AFD+QAVCSGFVY
Sbjct: 65  AARHALEAAGRKAEDIDLIIVATSTPDMVFPSSAAILQNKLGVAGCPAFDVQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ IR+G  R  +V+G++ FSRI+D++DR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADAMIRTGTARCALVVGAEVFSRILDFNDRTTCVLFGDGAGAVVLEASE------- 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           + GIL++ L +DG ++  L V G  S    +G   + M+G+AVFK AV    +       
Sbjct: 178 EPGILASDLHADGKHVGILCVPGHVSGGNVLGTPLLHMDGQAVFKLAVRVLEDAARATLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T  +IDW +PHQAN RI+     K+K+P +K+IVTV+ HGNTSAASIPLAL  AV+
Sbjct: 238 KAGKTEADIDWLIPHQANIRIMEGTAKKLKLPREKLIVTVNEHGNTSAASIPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            G+VKKG+ ++LE +GGGFT G VLL
Sbjct: 298 SGKVKKGETVMLEGVGGGFTWGAVLL 323


>gi|304388464|ref|ZP_07370570.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis ATCC 13091]
 gi|304337581|gb|EFM03744.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis ATCC 13091]
 gi|325129451|gb|EGC52281.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis OX99.30304]
 gi|325135508|gb|EGC58126.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M0579]
 gi|325201448|gb|ADY96902.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M01-240149]
 gi|325207429|gb|ADZ02881.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis NZ-05/33]
          Length = 320

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VLL++
Sbjct: 293 SGQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|187477618|ref|YP_785642.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella avium
           197N]
 gi|123513740|sp|Q2KUK5|FABH_BORA1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|115422204|emb|CAJ48728.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Bordetella avium
           197N]
          Length = 328

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/327 (48%), Positives = 214/327 (65%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP RV+SN +L     +  + TSD WI  R GI +RH+A +  TT+ L   
Sbjct: 8   SVIAGSGSYLPERVVSNDELAVELAQRGIQTSDEWIVERTGIRQRHLAERGVTTSVLATE 67

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR A+  A +   D+DLIIVATSTPD  FPSTA  +Q  LG K G AFD+QAVCSGF Y
Sbjct: 68  AARRAMADAGVGPADLDLIIVATSTPDFVFPSTACLVQANLGAKGGAAFDVQAVCSGFAY 127

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+TTADS++R+G VR  +VIG++ FS I+DW+DRSTCVLFGDGAGA++++  +       
Sbjct: 128 ALTTADSFVRAGRVRCALVIGAEVFSSILDWNDRSTCVLFGDGAGAVVIKAAD------- 180

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
           + GIL+  L +DGS    L   G  +  +  G   +RM+G+AVFK AV         V  
Sbjct: 181 EPGILAAQLHADGSQTKILCAAGNVAYGQVTGDPFLRMDGQAVFKQAVTVLDRSARDVCA 240

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +TI+ +DW VPHQAN RI+N +  K+ +  D+V+VTVD H NTSAAS+PLAL  A +
Sbjct: 241 EAGMTIDQVDWLVPHQANVRILNFLARKLNVSADRVVVTVDQHANTSAASVPLALDAARR 300

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           +GR+K G  +L++ +GGGFT G+VL R
Sbjct: 301 DGRIKPGQHVLMQGVGGGFTWGSVLAR 327


>gi|296158247|ref|ZP_06841079.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           Ch1-1]
 gi|295891583|gb|EFG71369.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           Ch1-1]
          Length = 329

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 225/335 (67%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     E  ++TSD WI  R GI  R+ A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPNRVTNQDLAERLAEQGIETSDEWIVARTGIHARYFAEPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
             A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVCSG
Sbjct: 66  FIASQRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL+  +    
Sbjct: 126 FAYAVATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILQASD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
              + G+L++ L +DGS+ + L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 182 ---EPGVLASALHADGSHSNILCTPGNVNGGVVSGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ E IDW +PHQAN RI+ S   K+ +P +++IVTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSAEQIDWLIPHQANIRIMQSTCRKLGLPQERMIVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|261378176|ref|ZP_05982749.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria cinerea
           ATCC 14685]
 gi|269145643|gb|EEZ72061.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria cinerea
           ATCC 14685]
          Length = 320

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 216/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGIDNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SAADK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+   L +DG+Y++ L   G  +  +  G   I M+G  VFK+AV+   ++ ++V   
Sbjct: 174 PGIIHGKLKADGNYLNLLNAPGQIAEGKICGSPYITMDGPGVFKFAVKMLAKIADEVIGE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T E IDW VPHQAN RII S    + +  DKVI+TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAEQIDWIVPHQANRRIIESTAKHLGLSMDKVILTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VL+ +
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLMEY 320


>gi|157827729|ref|YP_001496793.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia bellii
           OSU 85-389]
 gi|166233392|sp|A8GY06|FABH_RICB8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157803033|gb|ABV79756.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia bellii
           OSU 85-389]
          Length = 317

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 215/317 (67%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V+SN +L   VDT+D WI+ R GIS+RHIAG  E T+ +   AA  A+  A
Sbjct: 7   GCGGYLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDTEYTSHIALKAAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
           ++SV++IDLII  T+TPD +FPS A  +Q+ LG+    +FD+QAVC+GFVY V  A+S I
Sbjct: 67  DISVNEIDLIITCTTTPDNSFPSVATKLQSYLGLNNVPSFDLQAVCAGFVYGVQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW DR+TCVLFGDGAG++IL+       S  ++GI+ + +
Sbjct: 127 SSGKYKTILLIGAEKMTSLLDWEDRATCVLFGDGAGSVILQ------RSDDNSGIIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY +GG S + + G I M+G+ +F+ AVEK  + IE++  + + T+ +ID+
Sbjct: 181 FSSGADYEILYTNGGVSMNGSSGKIIMQGQKLFRLAVEKMHQSIEELLRNNNFTVNDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + +   KV+ TV+ H N SAASIPLAL+     G++KKGD +L
Sbjct: 241 FIPHQANVRIINKLAELLNVEDHKVVKTVEKHANCSAASIPLALSTIKASGKIKKGDIIL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ LLRW
Sbjct: 301 FSAIGAGLTWGSALLRW 317


>gi|308390011|gb|ADO32331.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           meningitidis alpha710]
 gi|325206823|gb|ADZ02276.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M04-240196]
          Length = 320

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 216/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL    +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDATGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SAADK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|121634176|ref|YP_974421.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           meningitidis FAM18]
 gi|161869298|ref|YP_001598465.1| 3-oxoacyl-(acyl carrier protein) synthase III [Neisseria
           meningitidis 053442]
 gi|166233384|sp|A1KRY9|FABH_NEIMF RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|189037896|sp|A9M142|FABH_NEIM0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120865882|emb|CAM09618.1| putative 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           meningitidis FAM18]
 gi|161594851|gb|ABX72511.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Neisseria
           meningitidis 053442]
 gi|319409775|emb|CBY90082.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-ACP
           synthase III; KAS III) [Neisseria meningitidis WUE 2594]
 gi|325127492|gb|EGC50421.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis N1568]
 gi|325131555|gb|EGC54262.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M6190]
 gi|325139190|gb|EGC61736.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis ES14902]
 gi|325141545|gb|EGC64014.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis 961-5945]
 gi|325197587|gb|ADY93043.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis G2136]
 gi|325204867|gb|ADZ00321.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Neisseria
           meningitidis M01-240355]
          Length = 320

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 217/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SAADK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|67459627|ref|YP_247251.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia felis
           URRWXCal2]
 gi|75535976|sp|Q4UK49|FABH_RICFE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|67005160|gb|AAY62086.1| 3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia felis
           URRWXCal2]
          Length = 317

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 212/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GSGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDTEYTSHLALKSAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SV+DIDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  RVSVNDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + V++IG++  + ++DWSDRSTCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 ASGKYKTVLLIGAEKMTSLLDWSDRSTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY +GG S +   G I M+G+ +F++A+EK  + IE +  +   ++ +ID+
Sbjct: 181 FSSGADYEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQQSIEDLLHANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+     G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSTLKASGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ L+RW
Sbjct: 301 FSAIGAGLTWGSALIRW 317


>gi|163856063|ref|YP_001630361.1| 3-oxoacyl-(acyl carrier protein) synthase III [Bordetella petrii
           DSM 12804]
 gi|254783786|sp|A9IIH4|FABH_BORPD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|163259791|emb|CAP42092.1| fabH [Bordetella petrii]
          Length = 328

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 216/330 (65%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLES-----IVDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  + + G G  LP RV+SN +L +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 5   MTYAVIAGSGSFLPERVVSNDELAAELATRNISTSDEWIVERTGIRQRHLAERGVTTSFL 64

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AAR AL  A +S  ++DLIIVATSTPD  FPSTA  +Q  LG K G AFD+QAVCSG
Sbjct: 65  ATEAARRALADAGVSAAEVDLIIVATSTPDYVFPSTACLVQANLGAKGGAAFDVQAVCSG 124

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA++TAD+++R+G  R  +VIG++ FSRI+DW+DRSTCVLFGDGAGA++L+       
Sbjct: 125 FVYALSTADAFVRAGRARCALVIGAEVFSRILDWNDRSTCVLFGDGAGAVVLK------- 177

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
           + +  GIL+  L +DGS    L   G  +     G   +RM+G+AVFK AV         
Sbjct: 178 AGSKPGILAAQLHADGSQTKILCAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 237

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V     + +  +DW VPHQAN RI+N +  K+++P +KV++TVD H NTSAAS+PLAL  
Sbjct: 238 VCAEAGVELAELDWLVPHQANVRILNFLARKLQVPTEKVVITVDSHANTSAASVPLALDA 297

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GR+K G  +L++ +GGGFT G+VL R
Sbjct: 298 ARRDGRIKPGQLVLMQGVGGGFTWGSVLAR 327


>gi|254804268|ref|YP_003082489.1| 3-oxoacyl-synthase III [Neisseria meningitidis alpha14]
 gi|254667810|emb|CBA03788.1| 3-oxoacyl-synthase III [Neisseria meningitidis alpha14]
          Length = 320

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 219/328 (66%), Gaps = 12/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAARLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L        S +D
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL--------SASD 172

Query: 180 T-GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
           T GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V +
Sbjct: 173 TPGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIE 232

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++
Sbjct: 233 EAGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIR 292

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++K+G  LLLE +GGGF  G VLL++
Sbjct: 293 SGQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|261393247|emb|CAX50870.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-ACP
           synthase III; KAS III) [Neisseria meningitidis 8013]
          Length = 320

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 217/327 (66%), Gaps = 10/327 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP   +SN DL   VDTSD WI  R GI  RHIA ++E T+ L   AA
Sbjct: 1   MQYAKISGTGSYLPANRVSNDDLAQKVDTSDEWITARTGIKFRHIAAENEKTSDLAAEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
           R AL  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+  G  AFD+QAVC+GF+YA
Sbjct: 61  RRALDAAGLDSGEIDLIIVATATPDMQFPSTATIVQQKLGITNGCPAFDVQAVCAGFMYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +TTA++YI+SG+ +  +VIG++TFSRIVDW+DR+TCVLFGDGAGA++L       S+   
Sbjct: 121 LTTANAYIKSGMAKNALVIGAETFSRIVDWNDRTTCVLFGDGAGAVVL-------SASDK 173

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDS 237
            GI+ + L +DG+Y+  L V G  +  +  G   I M+G  VFK+AV+   ++ + V + 
Sbjct: 174 PGIIHSKLKADGNYLKLLNVPGQIACGKVSGSPYISMDGPGVFKFAVKMLSKIADDVIEE 233

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
              T   IDW VPHQAN RII S    + +  DKV++TV  HGNTSAASIPLAL   ++ 
Sbjct: 234 AGYTAAQIDWIVPHQANRRIIESTAKHLGLSMDKVVLTVQDHGNTSAASIPLALDTGIRS 293

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G++K+G  LLLE +GGGF  G VLL++
Sbjct: 294 GQIKRGQNLLLEGIGGGFAWGAVLLQY 320


>gi|91784720|ref|YP_559926.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           xenovorans LB400]
 gi|91688674|gb|ABE31874.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           xenovorans LB400]
          Length = 329

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 225/335 (67%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     E  ++TSD WI  R GI  R+ A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPNRVTNQDLAKRLAEQGIETSDEWIVARTGIHARYFAEPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
             A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG++  G AFD+QAVCSG
Sbjct: 66  FIASQRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIRNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL+  +    
Sbjct: 126 FAYAVATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILQASD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
              + G+L++ L +DGS+ + L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 182 ---EPGVLASALHADGSHSNILCTPGNVNGGVVSGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ E IDW +PHQAN RI+ S   K+ +P +++IVTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSAEQIDWLIPHQANIRIMQSTCRKLGLPQERMIVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|307730540|ref|YP_003907764.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1003]
 gi|307585075|gb|ADN58473.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1003]
          Length = 329

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 226/335 (67%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     +  V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPARVTNQDLAERLAKQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
           + A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVCSG
Sbjct: 66  QIASQRAIEAADIDPQAIDLIIVATSTPDFVFPSTACLLQNKLGIKNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV+ ADS IRSG  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA+IL+       
Sbjct: 126 FAYAVSLADSLIRSGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQ------- 178

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
           + A+ G+LS+ L +DGS+   L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 179 ASAEPGVLSSALHADGSHSGILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ + IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSADQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|222055701|ref|YP_002538063.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp.
           FRC-32]
 gi|221564990|gb|ACM20962.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter sp.
           FRC-32]
          Length = 326

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 155/332 (46%), Positives = 215/332 (64%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR+ + G G +LP +VL+NSDLE +VDTSD WI  R GI  R IA + E T++    AA
Sbjct: 1   MIRTRITGTGSALPDKVLTNSDLEKMVDTSDEWITTRTGIKERRIAAEGEYTSTFATRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +  +++DLIIV T TPD  FPSTA  IQ+ L      AFD+ A CSGF+Y +
Sbjct: 61  EKALEMAGVKAEELDLIIVGTVTPDFPFPSTACVIQSNLNANNAAAFDVSAACSGFIYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +IR+G  ++ +VIG +  SRI+DW+DR+TC+LFGDGAGA ++E  E       D 
Sbjct: 121 SIADRFIRTGTAKKALVIGGEVLSRILDWTDRNTCLLFGDGAGAAVVEAQE------GDC 174

Query: 181 GILSTYLCSDGSYIDKLYVDG----GPSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           G+LST++ SDGSY + LY  G     P+T +T+      I+M G  VFK AV    ++  
Sbjct: 175 GVLSTHIRSDGSYWELLYQPGCGGRNPATQKTIDEKLMFIKMHGNEVFKLAVRAMEDVAR 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   +  LT ++ID F+PHQAN RII++I  ++ +   KV + ++ +GNTSAASIP+AL 
Sbjct: 235 QALAANDLTTDDIDLFIPHQANRRIIDAIGKRLGVAEGKVFINLERYGNTSAASIPIALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + GR+K GD +LL+A GGG T G+ L RW
Sbjct: 295 EANRSGRLKGGDVVLLDAFGGGLTWGSALFRW 326


>gi|293604002|ref|ZP_06686415.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Achromobacter
           piechaudii ATCC 43553]
 gi|292817606|gb|EFF76674.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Achromobacter
           piechaudii ATCC 43553]
          Length = 328

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 214/330 (64%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  S + G G  LP RV+SN +L +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 5   MKFSAIAGTGSFLPERVVSNDELAAELATRDIATSDEWIVERTGIRQRHLAERGVTTSQL 64

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              A+R AL  A +   +IDLIIVATSTPD  FPSTA  +Q  LG K   AFD+QAVCSG
Sbjct: 65  ATEASRRALADAGVDASEIDLIIVATSTPDFVFPSTACLVQANLGAKGSAAFDVQAVCSG 124

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+TTADS++R+G  R  +VIG++ FSRI+DW+DRSTCVLFGDGAGA++L+  +    
Sbjct: 125 FVYALTTADSFVRAGRARCALVIGAEVFSRILDWNDRSTCVLFGDGAGAVVLKASD---- 180

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + GI++  L +DGS +  L   G  +     G   +RM+G+AVFK AV         
Sbjct: 181 ---EPGIMAAQLHADGSQMKILSAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 237

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 + + ++DW +PHQAN RI+N +  K+ +P +KV++TVD H NTSAAS+PLAL  
Sbjct: 238 TCAEAGVEVADVDWLIPHQANVRILNFLARKLAVPVEKVVITVDSHANTSAASVPLALDA 297

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GRVK G  +L++ +GGGFT G+VL R
Sbjct: 298 ARRDGRVKPGQLILMQGVGGGFTWGSVLAR 327


>gi|91204943|ref|YP_537298.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia bellii
           RML369-C]
 gi|122426073|sp|Q1RKA5|FABH_RICBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|91068487|gb|ABE04209.1| 3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia bellii
           RML369-C]
          Length = 317

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 214/317 (67%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V+SN +L   VDT+D WI+ R GIS+RHIAG  E T+ +   AA  A+  A
Sbjct: 7   GCGGYLPPKVVSNDELAKFVDTNDEWIRTRTGISQRHIAGDTEYTSHIALKAAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
           ++SV++IDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY V  A+S I
Sbjct: 67  DISVNEIDLIITCTTTPDNSFPSVATKLQGYLGLNNVPSFDLQAVCAGFVYGVQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW DR+TCVLFGDGAG++IL+       S  ++GI+ + +
Sbjct: 127 SSGKYKTILLIGAEKMTSLLDWEDRATCVLFGDGAGSVILQ------RSDDNSGIIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY +GG S + + G I M+G+ +F+ AVEK  + IE++  + + T+ +ID+
Sbjct: 181 FSSGADYEILYTNGGVSMNGSSGKIIMQGQKLFRLAVEKMHQSIEELLRNNNFTVNDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + +   KV+ TV+ H N S+ASIPLAL+     G++KKGD +L
Sbjct: 241 FIPHQANVRIINKLAELLNVEDHKVVKTVEKHANCSSASIPLALSTLKASGKIKKGDIIL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ LLRW
Sbjct: 301 FSAIGAGLTWGSALLRW 317


>gi|332969342|gb|EGK08367.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Kingella kingae ATCC
           23330]
          Length = 327

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 217/326 (66%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+ + + G G  LP   ++N DL   +DTSD WI  R GI  RHI    E T+ L   AA
Sbjct: 9   MLYAQILGTGSYLPANRVTNDDLAQRIDTSDEWITTRTGIKARHIVADHEKTSDLAAEAA 68

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +S ++IDLI++AT+TPD  FP+TA  +QN+LG+    AFD+QAVC+GF+YA+
Sbjct: 69  RRALQDAGVSANEIDLIVLATATPDMQFPATATIVQNKLGIAGCPAFDVQAVCAGFMYAI 128

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTA++YI+SG+ ++ +VIG+D FSRIVDW+DR+TCVLFGDGAGA++L   E         
Sbjct: 129 TTANAYIKSGMAKKALVIGADVFSRIVDWNDRATCVLFGDGAGAVVLGASET-------A 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+ + L +DG+++D L V    S  +  G   + M+G+ VFK+AV++   + ++V    
Sbjct: 182 GIVHSKLHADGAHLDLLKVPAQMSEGQICGSPFVTMDGQGVFKFAVKQLSAVADEVITEA 241

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             T   IDW VPHQAN RII +    + +  DKVI+TV  H NTSAASIPLAL   +++G
Sbjct: 242 GYTTGQIDWLVPHQANRRIIEATAKHLGLSMDKVILTVQDHANTSAASIPLALDAGIRDG 301

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+++G  +LLE +GGGF  G VL+++
Sbjct: 302 RIQRGQNVLLEGIGGGFAWGAVLIQY 327


>gi|15604605|ref|NP_221123.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           prowazekii str. Madrid E]
 gi|9910699|sp|Q9ZCH1|FABH_RICPR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|3861300|emb|CAA15199.1| 3-OXOACYL-[ACYL-CARRIER-PROTEIN] SYNTHASE III (fabH) [Rickettsia
           prowazekii]
          Length = 317

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 212/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI +RHIAG  E T+ L   +A+ A+  A
Sbjct: 7   GSGGYLPPKIISNDELTKFVDTNDKWIRTRTGILQRHIAGDAEYTSHLAFKSAQKAIEDA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SVDDIDLII+ T+TPD +FPS A  +   LG+    +FD+QAVC+GF+Y +  A S I
Sbjct: 67  MISVDDIDLIIICTTTPDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLAHSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DRSTCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 VSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDGAGSVILQ------RSNDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY  GG S + T G I M+G+ +F++A+EK ++ IE +  +   ++ +ID+
Sbjct: 181 FSSGTDYEILYTSGGTSMNGTSGKIVMQGQKLFRHAIEKMLQSIEDLLYANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+   + G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSALKESGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G  L+RW
Sbjct: 301 FSAIGAGLTWGGALIRW 317


>gi|332529437|ref|ZP_08405396.1| 3-oxoacyl-(acyl carrier protein) synthase III [Hylemonella gracilis
           ATCC 19624]
 gi|332041083|gb|EGI77450.1| 3-oxoacyl-(acyl carrier protein) synthase III [Hylemonella gracilis
           ATCC 19624]
          Length = 325

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 217/330 (65%), Gaps = 14/330 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S + G G  LP + L+N+DL +      V+TSD WI  R GI  RH A +   ++ LG
Sbjct: 3   LYSRITGTGSFLPPQRLTNADLAARLAADGVETSDDWIVERTGIRARHFAAEGVMSSDLG 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGF 116
             AAR AL  A ++  DIDLIIVATSTPD  FPSTAV +QN++G     AFD+QAVCSGF
Sbjct: 63  AEAARRALQAAGLAASDIDLIIVATSTPDMIFPSTAVILQNKIGANGCQAFDVQAVCSGF 122

Query: 117 VYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSS 176
           +YA+T ADS IR+G   + +V+G++ FSRI+D+ DR+TCVLFGDGAGA++L+  E     
Sbjct: 123 IYALTVADSMIRAGAASKALVVGAEVFSRIIDFKDRTTCVLFGDGAGAVVLQASETP--- 179

Query: 177 MADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKV 234
               GILS+ L +DG ++  L   G  +  + +G   ++M+G+AVFK AV    E    V
Sbjct: 180 ----GILSSDLKADGKHVGILCTPGTVAAGKVLGDPFLKMDGQAVFKQAVTVLDEASRAV 235

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                 T  +IDW VPHQAN RI+     K+K+  +KV+VTVD HGNTSAASIPLAL   
Sbjct: 236 LAKAGKTEADIDWLVPHQANIRIMMGAAKKLKLAPEKVVVTVDQHGNTSAASIPLALDHG 295

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++G+VK+GD +LLEA+GGG T G VLL +
Sbjct: 296 VRQGQVKRGDTVLLEAVGGGLTWGAVLLTY 325


>gi|53720048|ref|YP_109034.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei K96243]
 gi|76810561|ref|YP_334288.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 1710b]
 gi|126439189|ref|YP_001059813.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 668]
 gi|134277378|ref|ZP_01764093.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 305]
 gi|167739563|ref|ZP_02412337.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 14]
 gi|167816765|ref|ZP_02448445.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 91]
 gi|167825173|ref|ZP_02456644.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 9]
 gi|167895258|ref|ZP_02482660.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 7894]
 gi|167903642|ref|ZP_02490847.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei NCTC 13177]
 gi|167911892|ref|ZP_02498983.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 112]
 gi|167919887|ref|ZP_02506978.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei BCC215]
 gi|217421082|ref|ZP_03452587.1| beta-ketoacyl-acyl-carrier-protein synthase III [Burkholderia
           pseudomallei 576]
 gi|226199929|ref|ZP_03795479.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei Pakistan 9]
 gi|237813208|ref|YP_002897659.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           pseudomallei MSHR346]
 gi|254184197|ref|ZP_04890787.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 1655]
 gi|254191232|ref|ZP_04897736.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254195863|ref|ZP_04902289.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei S13]
 gi|254260291|ref|ZP_04951345.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei 1710a]
 gi|254296858|ref|ZP_04964311.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 406e]
 gi|81607797|sp|Q63S83|FABH_BURPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|123598457|sp|Q3JQ65|FABH_BURP1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971542|sp|A3NBU2|FABH_BURP6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|52210462|emb|CAH36445.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei K96243]
 gi|76580014|gb|ABA49489.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 1710b]
 gi|126218682|gb|ABN82188.1| beta-ketoacyl-acyl-carrier-protein synthase III [Burkholderia
           pseudomallei 668]
 gi|134251028|gb|EBA51107.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 305]
 gi|157806793|gb|EDO83963.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 406e]
 gi|157938904|gb|EDO94574.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei Pasteur 52237]
 gi|169652608|gb|EDS85301.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei S13]
 gi|184214728|gb|EDU11771.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           pseudomallei 1655]
 gi|217396494|gb|EEC36511.1| beta-ketoacyl-acyl-carrier-protein synthase III [Burkholderia
           pseudomallei 576]
 gi|225927985|gb|EEH24022.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei Pakistan 9]
 gi|237505704|gb|ACQ98022.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           pseudomallei MSHR346]
 gi|254218980|gb|EET08364.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei 1710a]
          Length = 329

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 216/331 (65%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IR+G  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALATADSFIRTGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|294636830|ref|ZP_06715165.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Edwardsiella tarda
           ATCC 23685]
 gi|291089973|gb|EFE22534.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Edwardsiella tarda
           ATCC 23685]
          Length = 317

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 147/324 (45%), Positives = 210/324 (64%), Gaps = 8/324 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP +V +N+DLE +V+TSD WI  R GI  R IA  DE+ A++   AA+
Sbjct: 1   MHTRILGTGSYLPVQVRTNADLEKMVETSDEWIVSRTGIRERRIAAPDESVATMAFEAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYAV 120
            AL  A++  DDI LIIVAT++ +  FPS A  +QN LGM+ G  AFD+ A C+GF YA+
Sbjct: 61  HALEMAQVDKDDIGLIIVATTSANHAFPSAACEVQNLLGMRNGCPAFDVAAACAGFTYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD YI+ G +R  +VIGSD  +R VD  DR T +LFGDGAGA++L   E         
Sbjct: 121 SIADQYIKGGAIRHALVIGSDALARTVDPQDRGTVILFGDGAGAVVLGAAE-------QP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILST++ +DG Y + L +   P  +     + M G  VFK AV +   ++++   +  L
Sbjct: 174 GILSTHIHADGRYGELLTLPNRPRHTEDQAYLTMAGNEVFKVAVTELAHIVDETLQANQL 233

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + E++DW VPHQAN RII++   K+ +  + V+VT+D HGNTSAAS+P AL  AV++GR+
Sbjct: 234 SREDLDWLVPHQANLRIISATAKKLGMSLESVVVTLDRHGNTSAASVPAALDEAVRDGRI 293

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  +LLEA GGGFT G+ L+R+
Sbjct: 294 QRGQLILLEAFGGGFTWGSALVRF 317


>gi|126453602|ref|YP_001067100.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei 1106a]
 gi|242317196|ref|ZP_04816212.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei 1106b]
 gi|166971541|sp|A3NXM9|FABH_BURP0 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|126227244|gb|ABN90784.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei 1106a]
 gi|242140435|gb|EES26837.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           pseudomallei 1106b]
          Length = 329

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 216/331 (65%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARHFAASDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IR+G  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALATADSFIRTGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|167720572|ref|ZP_02403808.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei DM98]
          Length = 329

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 216/331 (65%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LVAAQRAIKAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IR+G  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALATADSFIRTGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|77919037|ref|YP_356852.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pelobacter
           carbinolicus DSM 2380]
 gi|77545120|gb|ABA88682.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Pelobacter
           carbinolicus DSM 2380]
          Length = 327

 Score =  295 bits (754), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 212/332 (63%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R  V G G  LP ++L+N DLE IVDTSD WI  R GI  RHIA + E T+ L   AA
Sbjct: 2   MKRMCVTGTGSYLPEKILTNKDLEKIVDTSDEWIATRTGIRERHIAAEGEHTSDLATEAA 61

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R A+  A +  +DIDLIIVAT T D  +P+TA  +Q  L   R FAFD+ A CSGF+Y +
Sbjct: 62  RRAMTMAGVVAEDIDLIIVATVTGDFNWPATACLVQANLQATRAFAFDISAACSGFLYGL 121

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+YI++G  ++V++IG++ FSRIVDW+DR TC+LFGDGAGA++LE      +S  D 
Sbjct: 122 SVADNYIKTGSAKKVLLIGAEVFSRIVDWTDRGTCILFGDGAGAVVLE------ASDGDR 175

Query: 181 GILSTYLCSDGSYIDKLYVDGGPS-----TSRTVG---CIRMEGKAVFKYAVEKAVELIE 232
           G+LS +L +DGS    LY  G  S     +S + G    ++M+G  VFK AV    +  E
Sbjct: 176 GMLSCHLHADGSCWPLLYQMGQGSRNPADSSASEGHNPFVQMQGNEVFKVAVRSLCDAGE 235

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   +  +   ++D  +PHQAN RI+ +   ++K+P +KV+V VD  GNTSAASI +AL 
Sbjct: 236 EALAANDMNAGDVDLLIPHQANRRILEATAKRLKVPLEKVMVNVDRVGNTSAASIAIALD 295

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + GRVK+ D LLL A GGGFT G  L RW
Sbjct: 296 EAHRAGRVKQDDILLLNAFGGGFTWGAALFRW 327


>gi|323526872|ref|YP_004229025.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1001]
 gi|323383874|gb|ADX55965.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1001]
          Length = 329

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 166/335 (49%), Positives = 226/335 (67%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     +  V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPARVTNQDLAERLAKQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
           + A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG++  G AFD+QAVCSG
Sbjct: 66  QIASQRAIEAADIDPQAIDLIIVATSTPDFVFPSTACLLQNKLGIRNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV+ ADS IR G  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA+IL+       
Sbjct: 126 FAYAVSMADSLIRGGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQ------- 178

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
           + A+ G+LS+ L +DGS+ + L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 179 ASAEPGVLSSALHADGSHSNILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ + IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSADQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|329900905|ref|ZP_08272637.1| 3-oxoacyl-(acyl-carrier-protein) synthase, KASIII [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327549317|gb|EGF33889.1| 3-oxoacyl-(acyl-carrier-protein) synthase, KASIII [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 328

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 218/330 (66%), Gaps = 17/330 (5%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP   ++N  L +      V+TSD WI  R GIS RH A     ++ L   
Sbjct: 5   SKIIGTGSYLPPDRVTNEQLVARLALTGVETSDEWIFSRSGISARHYADPAVFSSDLAVQ 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQ--TFPSTAVNIQNRLGMKRGFA-FDMQAVCSG 115
           AA++AL  A ++ +DIDLIIVATSTPD    FPSTA  +Q +LG+  G A  D+QAVCSG
Sbjct: 65  AAQNALEMAGLTGNDIDLIIVATSTPDHFGGFPSTACVVQRKLGITNGCAAVDVQAVCSG 124

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F+YAV+ ADS+IRSG  ++ +VIG++ FSRI+D+ DR TCVLFGDGAGA+IL       S
Sbjct: 125 FIYAVSVADSFIRSGAHKKALVIGAEVFSRILDFKDRGTCVLFGDGAGAIIL-------S 177

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
           + A+ GIL+T L +DGSY D L V+GG S     G   + M+G AVFK AV    ++  +
Sbjct: 178 AAAEPGILATKLHADGSYGDILCVEGGVSGGVLAGSGFLTMDGPAVFKLAVSLLEKVAVE 237

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
             DS  +    +DW +PHQAN RI+ S   K+K+P +K++VTVD HGNTSAASIPLAL  
Sbjct: 238 ALDSAGIAASELDWLIPHQANIRIMQSTAKKLKMPAEKMVVTVDQHGNTSAASIPLALDT 297

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           AV++GRVK G  +L+E +GGGFT G V+ R
Sbjct: 298 AVRDGRVKPGQHILMEGVGGGFTWGAVVAR 327


>gi|317401927|gb|EFV82533.1| FabH protein [Achromobacter xylosoxidans C54]
          Length = 324

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/330 (47%), Positives = 212/330 (64%), Gaps = 14/330 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASL 55
           M  S + G G  LP RV+SN  L +      + TSD WI  R GI +RH+A +  TT+ L
Sbjct: 1   MKYSAIAGTGSFLPERVVSNDALAAELATRDIATSDEWIVERTGIRQRHLAERGVTTSQL 60

Query: 56  GEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSG 115
              AAR AL  A +   ++DLI++ATSTPD  FPSTA  +Q  LG K   AFD+QAVCSG
Sbjct: 61  ATEAARRALADAGVDASEVDLIVLATSTPDFVFPSTACLVQANLGAKGSAAFDVQAVCSG 120

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           FVYA+TTADS+IR+G  R  +VIG++ FSRI+DW+DRSTCVLFGDGAGA++L+  +    
Sbjct: 121 FVYALTTADSFIRAGRARCALVIGAEVFSRILDWNDRSTCVLFGDGAGAVVLKASD---- 176

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
                GI++  L +DGS +  L   G  +     G   +RM+G+AVFK AV         
Sbjct: 177 ---KPGIMAAQLHADGSQMKILSAAGNVAYGDVTGDPFLRMDGQAVFKQAVTVLDRSARD 233

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 + I ++DW +PHQAN RI+N +  K+ +P +KV++TVD H NTSAAS+PLAL  
Sbjct: 234 TCAEAGIEIADVDWLIPHQANVRILNFLARKLAVPVEKVVITVDSHANTSAASVPLALDA 293

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A ++GRVK G  +L++ +GGGFT G+VL R
Sbjct: 294 ARRDGRVKAGQLVLMQGVGGGFTWGSVLAR 323


>gi|292572421|gb|ADE30336.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           prowazekii Rp22]
          Length = 317

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 211/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI +RHIAG  E T+ L   +A+ A+  A
Sbjct: 7   GSGGYLPPKIISNDELTKFVDTNDKWIRTRTGILQRHIAGDAEYTSHLAFKSAQKAIEDA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SVDDIDLII  T+TPD +FPS A  +   LG+    +FD+QAVC+GF+Y +  A S I
Sbjct: 67  MISVDDIDLIITCTTTPDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLAHSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DRSTCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 VSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDGAGSVILQ------RSNDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY  GG S + T G I M+G+ +F++A+EK ++ IE +  +   ++ +ID+
Sbjct: 181 FSSGTDYEILYTSGGTSMNGTSGKIVMQGQKLFRHAIEKMLQSIEDLLYANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+   + G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSALKESGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G  L+RW
Sbjct: 301 FSAIGAGLTWGGALIRW 317


>gi|51473940|ref|YP_067697.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia typhi
           str. Wilmington]
 gi|56748940|sp|Q68VX7|FABH_RICTY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|51460252|gb|AAU04215.1| Beta-ketoacyl-ACP synthase [Rickettsia typhi str. Wilmington]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 212/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP++++SN +L   VDT+D WI+ R GI +RHIAG  E T+ L   +A+ A+  A
Sbjct: 7   GSGGYLPQKIISNDELTKFVDTNDKWIRTRTGIFQRHIAGDTEYTSHLALKSAQKAIEDA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SVDDIDLII  T+TPD +FPS A  +   LG+    +FD+QAVC+GF+Y +   +S I
Sbjct: 67  MISVDDIDLIITCTTTPDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFIYGLQLTNSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DRSTCVLFGDGAG++IL+       S  ++G++ + +
Sbjct: 127 VSGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDGAGSVILQ------RSNDESGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY  GG S + T G I M+G+ +F++A+ K ++ IE +  +   ++ +ID+
Sbjct: 181 FSSGTDYEILYTSGGTSMNGTSGKIVMQGQKLFRHAIAKMLQSIEDLLHANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+   + G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSTLKESGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ L+RW
Sbjct: 301 FSAIGAGLTWGSALIRW 317


>gi|157804142|ref|YP_001492691.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           canadensis str. McKiel]
 gi|166233393|sp|A8EZX3|FABH_RICCK RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157785405|gb|ABV73906.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           canadensis str. McKiel]
          Length = 317

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 211/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIA   E T+ L   +A  A+  A
Sbjct: 7   GCGQYLPSKIVSNDELTKFVDTNDEWIRTRTGITQRHIADDTEYTSHLALKSAEKAIEDA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +S +DIDLII+ T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISANDIDLIIICTTTPDHSFPSVATKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            S   + V++IG++  + ++DW+DRSTCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 ASSKYKTVLLIGAEKMTSLLDWNDRSTCVLFGDGAGSVILQ------RSSDDSGLIESNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G   D LY +GG S + T G I M+G+ +F++A+EK  + IE++  +   ++ +ID+
Sbjct: 181 FSSGIDYDILYTNGGISMNGTSGKIIMQGQKLFRHAIEKMQQSIEELLCANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   K+I TV+ H N SAASIPLAL+     G++KKGD LL
Sbjct: 241 FIPHQANVRIINKLAELLNIEEHKIIKTVEKHANCSAASIPLALSTLKGLGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ L+RW
Sbjct: 301 FSAIGAGLTWGSALIRW 317


>gi|53725370|ref|YP_102326.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia mallei
           ATCC 23344]
 gi|67641123|ref|ZP_00439908.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia mallei
           GB8 horse 4]
 gi|121598640|ref|YP_993783.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia mallei
           SAVP1]
 gi|124385315|ref|YP_001028751.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia mallei
           NCTC 10229]
 gi|126451031|ref|YP_001081341.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia mallei
           NCTC 10247]
 gi|167000766|ref|ZP_02266573.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia mallei
           PRL-20]
 gi|167846670|ref|ZP_02472178.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           pseudomallei B7210]
 gi|254177578|ref|ZP_04884233.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           ATCC 10399]
 gi|254199219|ref|ZP_04905585.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           FMH]
 gi|254205526|ref|ZP_04911878.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           JHU]
 gi|254357693|ref|ZP_04973966.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           2002721280]
 gi|81605448|sp|Q62LU2|FABH_BURMA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971538|sp|A3MM55|FABH_BURM7 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971539|sp|A2S9Y2|FABH_BURM9 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971540|sp|A1V6D0|FABH_BURMS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|52428793|gb|AAU49386.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           ATCC 23344]
 gi|121227450|gb|ABM49968.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           SAVP1]
 gi|124293335|gb|ABN02604.1| beta-ketoacyl-acyl-carrier-protein synthase III [Burkholderia
           mallei NCTC 10229]
 gi|126243901|gb|ABO06994.1| beta-ketoacyl-acyl-carrier-protein synthase III [Burkholderia
           mallei NCTC 10247]
 gi|147748815|gb|EDK55889.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           FMH]
 gi|147752969|gb|EDK60034.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           JHU]
 gi|148026820|gb|EDK84841.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           2002721280]
 gi|160698617|gb|EDP88587.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia mallei
           ATCC 10399]
 gi|238521988|gb|EEP85435.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia mallei
           GB8 horse 4]
 gi|243063316|gb|EES45502.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia mallei
           PRL-20]
          Length = 329

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 215/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIRARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IR+G  R  +VIG++ FSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALATADSFIRTGQHRTALVIGAEAFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKAELASEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|330999181|ref|ZP_08322900.1| 3-oxoacyl-(acyl carrier protein) synthase III [Parasutterella
           excrementihominis YIT 11859]
 gi|329575381|gb|EGG56925.1| 3-oxoacyl-(acyl carrier protein) synthase III [Parasutterella
           excrementihominis YIT 11859]
          Length = 328

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/329 (47%), Positives = 218/329 (66%), Gaps = 15/329 (4%)

Query: 4   STVRGIGLSLPRRVLSN----SDLESI-VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S +   G  LP+R +SN     DL  I V+TSD WI+ R GI +R++A  +E+T  L   
Sbjct: 7   SRIASTGSFLPKRAVSNEELAQDLAKIGVETSDEWIRTRTGIEQRYLASGEESTTYLASE 66

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AA+ AL     S D+IDLIIVAT+TPD  FPSTA  +Q  LG     AFD+QAVCSGF Y
Sbjct: 67  AAKQALEAGGFSPDEIDLIIVATTTPDSVFPSTACQVQAILGASGAGAFDIQAVCSGFAY 126

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS IR+G  +RV+VIG++T SR++DW DR+TCVLFGDGAGA++LE  +       
Sbjct: 127 ALSIADSMIRAGSAKRVLVIGAETLSRVLDWKDRTTCVLFGDGAGAVVLEKSD------- 179

Query: 179 DTGILSTYLCSDGSY-IDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVF 235
           + GIL++ L +DG+  +  L  D      + VG   IRM+G+ VFK AVEK  E    V 
Sbjct: 180 EPGILASELKADGTRGVHVLAADSHIDGGKVVGDPFIRMDGRLVFKAAVEKMTESARNVL 239

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
              +L   ++D ++PHQAN RI+N + +K+ I  + ++++V+ HGNTSAAS+PLAL  A 
Sbjct: 240 TKANLATNDVDLYIPHQANLRIMNMVREKLGIDEEHLMISVNQHGNTSAASVPLALDKAH 299

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + GR+K+GD +LL+ +GGGFT  +VLL++
Sbjct: 300 RSGRLKRGDLVLLQGVGGGFTWASVLLKF 328


>gi|194290166|ref|YP_002006073.1| 3-oxoacyl-(acyl carrier protein) synthase iii [Cupriavidus
           taiwanensis LMG 19424]
 gi|254783800|sp|B3R213|FABH_CUPTR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|193224001|emb|CAQ70010.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III) (KAS III) [Cupriavidus taiwanensis LMG
           19424]
          Length = 326

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 217/324 (66%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R ++N +L     E  ++TSD WI  R GIS RH A  D T+++L   AA  
Sbjct: 9   GTGSYLPPRRVTNHELAAQLAEKGIETSDEWIVSRSGISARHWAEPDVTSSTLAVKAAEQ 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   DIDLIIVATSTPD  FPSTA  +Q +LG+     AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRQDIDLIIVATSTPDFVFPSTACIVQEKLGITNHCPAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L       S+  + G
Sbjct: 129 TADKFIRSGSHRNVLVIGTEVFSRILDFNDRTTCVLFGDGAGAVVL-------SASDEPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILS+ + SDGS++D L V G  +     G   + M+G+AVFK AV    ++  +  ++  
Sbjct: 182 ILSSAMHSDGSHVDILCVPGNVAGGNITGNPFLHMDGQAVFKLAVNVLDKVAREAMEAAS 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           ++ + +DW +PHQAN RI+     K+ +P ++++ TV  HGNTSAASIPLAL VAV++GR
Sbjct: 242 VSPDQVDWLIPHQANIRIMQGTAKKLGLPAERMVATVHEHGNTSAASIPLALDVAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ G  +L+E +GGGFT G VLLR
Sbjct: 302 IRPGHTVLMEGVGGGFTWGAVLLR 325


>gi|71907643|ref|YP_285230.1| 3-oxoacyl-(acyl carrier protein) synthase III [Dechloromonas
           aromatica RCB]
 gi|71847264|gb|AAZ46760.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Dechloromonas
           aromatica RCB]
          Length = 319

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 214/322 (66%), Gaps = 10/322 (3%)

Query: 6   VRGIGLSLPRRVLSNSDLESI-VDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDAL 64
           + G G  LP   +SNSDL +  +DTSD WI  R GI  R++A    T++ LG  AA+ AL
Sbjct: 5   LSGTGSYLPGNPVSNSDLAARGIDTSDEWIVTRTGIRSRYLAPPGTTSSELGLIAAQKAL 64

Query: 65  HHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTAD 124
             A ++  D+DLIIVATSTPD  FPSTA  IQ +LG K   AFD+QAVC+GF YA+  A+
Sbjct: 65  EMAGVAGADLDLIIVATSTPDFIFPSTACLIQGKLGNKGAAAFDVQAVCAGFTYALGIAE 124

Query: 125 SYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILS 184
            +I SG  ++ +VIG++ FSRI+DW+DR TCVLFGDGAGA++LE  +         GIL+
Sbjct: 125 KFICSGSHKKALVIGAEVFSRILDWNDRGTCVLFGDGAGAVVLEAAD-------KPGILA 177

Query: 185 TYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           T + +DGS    L V G     +  G   +RM+G+AVFK+AV    ++ EKV  +  +  
Sbjct: 178 TAMHADGSQSGILNVPGQICGGQVTGDPFLRMDGQAVFKFAVRVLADIAEKVCQAADIQT 237

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            ++DW +PHQAN RII +   K+ +  DKVIVTVD HGNTSAAS+PLAL  AV++GR+++
Sbjct: 238 SDVDWLIPHQANIRIIEATGKKLGVDRDKVIVTVDRHGNTSAASVPLALDEAVRDGRIQR 297

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  +LLE +GGGFT G  LL +
Sbjct: 298 GQKVLLEGVGGGFTWGAALLEF 319


>gi|294340998|emb|CAZ89393.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3
           (3-oxoacyl-[acyl-carrier-protein] synthase III)
           (Beta-ketoacyl-ACP synthase III) (KAS III) (EcFabH)
           [Thiomonas sp. 3As]
          Length = 325

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 211/328 (64%), Gaps = 14/328 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G +LP R +SN +L     +  V+TSD WI  R GI  RH A +  T+  LGE 
Sbjct: 5   SRISGTGSALPPRKVSNEELAADLAQRGVETSDAWIVARTGIRFRHFAEEGTTSVDLGEQ 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A +   DI LIIVATSTPD  FPS A  IQ RLG   G AFD+QAVC+GFVY
Sbjct: 65  AARRALESAGLHAHDIGLIIVATSTPDMIFPSNAALIQGRLGAAGGAAFDVQAVCAGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+  AD ++RSG+ R  +VIG++ FS+I+D++DR+TCVLFGDGAGA++L   E       
Sbjct: 125 ALAVADQFVRSGMTRHALVIGAEVFSQILDFNDRTTCVLFGDGAGAVVLSASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
             G+L++ L +DG     L   G  S+ +  G   ++M+G+AVFK AV    ++  +  D
Sbjct: 180 --GVLASALHADGRQSSILCTPGRVSSGQVAGSPFLKMDGQAVFKQAVHVLEDVAREALD 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
                  ++DW VPHQAN RI+     K+ IP DK++VTVD HGNTSAASIPLAL VAV+
Sbjct: 238 KADRLPADVDWMVPHQANIRIMTHTAKKLGIPLDKIVVTVDQHGNTSAASIPLALDVAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++++GD LL EA+GGG T G  ++ +
Sbjct: 298 SGQIQRGDTLLFEAVGGGLTWGAAVVDY 325


>gi|83719007|ref|YP_442252.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           thailandensis E264]
 gi|167581138|ref|ZP_02374012.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           thailandensis TXDOH]
 gi|167619222|ref|ZP_02387853.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           thailandensis Bt4]
 gi|257138445|ref|ZP_05586707.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           thailandensis E264]
 gi|123537178|sp|Q2SXU7|FABH_BURTA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|83652832|gb|ABC36895.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           thailandensis E264]
          Length = 329

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 215/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  FVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+  ADS+IR+G  R  +++G++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALAMADSFIRTGQHRTALIVGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E IDW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKAALAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRY 329


>gi|212213023|ref|YP_002303959.1| 3-oxoacyl-(acyl carrier protein) synthase III [Coxiella burnetii
           CbuG_Q212]
 gi|254783799|sp|B6J1I6|FABH_COXB2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|212011433|gb|ACJ18814.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Coxiella burnetii
           CbuG_Q212]
          Length = 319

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 216/325 (66%), Gaps = 9/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IAGKDETTASLGEAA 59
           M  + ++G+G  +P+++LSN+DLE +V+T+D WI +RVG+  RH IA   + T ++   A
Sbjct: 1   MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANSPDNTTTMAVDA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVY 118
           A+ A+  AE+    ID+IIV T+T +  FPSTA  +Q  L ++    AFD+ A C+GFVY
Sbjct: 61  AKRAIEMAEIDPAVIDMIIVGTATAEYYFPSTACLVQKHLNLREDIPAFDINAACAGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ AD YIR+   + ++VIG D+ +++VDW DRSTC+LFGDGAGA+IL+       +  
Sbjct: 121 ALSIADQYIRNEGAKHILVIGVDSLTKVVDWKDRSTCILFGDGAGAVILQ-------AHK 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GIL+T L ++G Y D +    G     +V  + M GK VFK AV K  E+++++ + +
Sbjct: 174 EPGILNTILHANGDYSDLITAKSGVWERESVPHLHMYGKEVFKLAVTKLGEIVDEIIEKS 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW +PHQAN RII +   ++ +P ++VI+T++ HGNTSAASIPLAL  AV+ G
Sbjct: 234 GLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQHGNTSAASIPLALDAAVRAG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K+GD LLLEA G G   G  LL+
Sbjct: 294 KIKRGDTLLLEAFGAGLAWGAALLK 318


>gi|238022649|ref|ZP_04603075.1| hypothetical protein GCWU000324_02558 [Kingella oralis ATCC 51147]
 gi|237865852|gb|EEP66988.1| hypothetical protein GCWU000324_02558 [Kingella oralis ATCC 51147]
          Length = 319

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 220/326 (67%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G  LP + ++N +L   VDTSD WI  R GI  RHIA + E T+ L  AAA
Sbjct: 1   MKHAKILGTGSYLPAQRVTNEELARRVDTSDEWITTRTGIKARHIAAEHEKTSDLAHAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A ++  +IDLIIVAT+TPD  FP+TA  +Q +LG+    AFD+QAVC+GFVYA+
Sbjct: 61  LRALDDAGIAAGEIDLIIVATATPDMQFPATATIVQQKLGVSGCPAFDVQAVCAGFVYAM 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA++YI+SG+ ++ +VIG+DTFSRI+DWSDR TCVLFGDGAGA++L      G+S  + 
Sbjct: 121 ATANAYIKSGMAKKALVIGADTFSRIMDWSDRRTCVLFGDGAGAVVL------GAS-DEA 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GI+ + L +DG+Y+  L      +     G   ++M+G+ VFK+AV++   + ++V    
Sbjct: 174 GIIHSKLHADGNYLSLLNTPAQIADGAICGTPFLQMDGQGVFKFAVKQLAAVADEVLQEA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
             T E IDW VPHQAN RII++    + +P +K+I+TV  H NTSAASIPLAL   +K+G
Sbjct: 234 GYTAEQIDWLVPHQANKRIIDATAKHLGLPEEKIILTVQEHANTSAASIPLALDAGIKDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+++G  L++E +GGGF  G +L+R+
Sbjct: 294 RIRRGQHLMMEGIGGGFAWGAMLVRY 319


>gi|295677189|ref|YP_003605713.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1002]
 gi|295437032|gb|ADG16202.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           CCGE1002]
          Length = 329

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 217/331 (65%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL        V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSCLPPNRVTNQDLAERLARQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
             A++ A+  A++    IDLI+VATSTPD  FPSTA  +QN+LG+K +G AFD+QAVCSG
Sbjct: 66  LIASQRAIEAADIDPQSIDLIVVATSTPDFVFPSTACLLQNKLGIKNQGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV T DS IR+G  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA+IL+  +    
Sbjct: 126 FAYAVATVDSLIRTGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQASD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + G+LS+ L +DGS+ + L   G  +     G   + M+G+AVFK AV     +  +
Sbjct: 182 ---EPGVLSSALHADGSHSNILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLERVAIE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
             +   L  E IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLAL V
Sbjct: 239 ALEKAELKPEQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 299 AVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|170695409|ref|ZP_02886554.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           graminis C4D1M]
 gi|170139600|gb|EDT07783.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           graminis C4D1M]
          Length = 329

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 166/335 (49%), Positives = 224/335 (66%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL     +  V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSYLPPARVTNQDLAERLAKQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
           + A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVCSG
Sbjct: 66  QFASQRAIEAADIDPQAIDLIIVATSTPDFVFPSTACLLQNKLGIKNHGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV  ADS IR G  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA+IL+       
Sbjct: 126 FAYAVAMADSLIRGGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQ------- 178

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
           + A+ G+L++ L +DGS+   L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 179 ASAEPGVLASALHADGSHSGILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK     +L+ + IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----ANLSADQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|113868531|ref|YP_727020.1| 3-oxoacyl-(acyl carrier protein) synthase III [Ralstonia eutropha
           H16]
 gi|123032841|sp|Q0K8L9|FABH_RALEH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|113527307|emb|CAJ93652.1| 3-Oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia eutropha
           H16]
          Length = 326

 Score =  292 bits (748), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 212/324 (65%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R ++N DL     E  ++TSD WI  R GIS RH A  D T++ L   AA  
Sbjct: 9   GTGSYLPPRRVTNHDLATQLAEKGIETSDDWIVSRSGISARHWAEPDVTSSDLAVKAAEQ 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYAVT 121
           A+  A +    IDLIIVATSTPD  FPSTA  +Q +LG+     AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRQSIDLIIVATSTPDFVFPSTACIVQEKLGITNHCPAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L   E       + G
Sbjct: 129 TADKFIRSGSHRNVLVIGTEVFSRILDFNDRTTCVLFGDGAGAVLLSASE-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST + SDG ++D L V G  +     G   + M+G+AVFK AV    ++  +  ++  
Sbjct: 182 ILSTAMHSDGRHVDILCVPGNVAGGNITGNPFLHMDGQAVFKLAVNVLDKVAREAMEAAS 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +T   IDW +PHQAN RI+     K+ +P ++++ TV  HGNTSAASIPLAL VAV++GR
Sbjct: 242 VTPGQIDWLIPHQANIRIMQGTAKKLGLPAERMVATVHEHGNTSAASIPLALDVAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ G  +L+E +GGGFT G VLLR
Sbjct: 302 IRAGQTVLMEGVGGGFTWGAVLLR 325


>gi|157964922|ref|YP_001499746.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia massiliae
           MTU5]
 gi|166971602|sp|A8F2R3|FABH_RICM5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157844698|gb|ABV85199.1| 3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia massiliae
           MTU5]
          Length = 317

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 211/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVDTNDAWIRTRTGITQRHIAGDTEYTSHLALESAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SV+DIDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISVNDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DR+TCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 SSGKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGSVILQ------RSRDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY +GG S +   G I M+G+ +F++A+EK  + I+ +  +   ++ +ID+
Sbjct: 181 FSSGADYEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQQSIKDLLHANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+     G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSTLKASGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+  +RW
Sbjct: 301 FSAIGAGLTWGSAFIRW 317


>gi|153209896|ref|ZP_01947533.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Coxiella burnetii
           'MSU Goat Q177']
 gi|165924167|ref|ZP_02219999.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Coxiella burnetii
           RSA 334]
 gi|212218902|ref|YP_002305689.1| 3-oxoacyl-(acyl carrier protein) synthase III [Coxiella burnetii
           CbuK_Q154]
 gi|254783798|sp|B6J8E5|FABH_COXB1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120575220|gb|EAX31844.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Coxiella burnetii
           'MSU Goat Q177']
 gi|165916392|gb|EDR34996.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Coxiella burnetii
           RSA 334]
 gi|212013164|gb|ACJ20544.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Coxiella burnetii
           CbuK_Q154]
          Length = 319

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 144/325 (44%), Positives = 216/325 (66%), Gaps = 9/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IAGKDETTASLGEAA 59
           M  + ++G+G  +P+++LSN+DLE +V+T+D WI +RVG+  RH IA   + T ++   A
Sbjct: 1   MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANSPDNTTTMAVDA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVY 118
           A+ A+  A +    ID+IIV T+T +  FPSTA  +Q  L ++    AFD+ A C+GFVY
Sbjct: 61  AKRAIEMAGIDSAVIDMIIVGTATAEYYFPSTACLVQKHLNLREDIPAFDINAACAGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ AD YIR+G  + ++VIG D+ +++VDW DRSTC+LFGDGAGA+IL+       +  
Sbjct: 121 ALSIADQYIRNGGAKHILVIGVDSLTKVVDWKDRSTCILFGDGAGAVILQ-------AHK 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GIL+T L ++G Y D +    G     +V  + M GK VFK AV K  E+++++ + +
Sbjct: 174 EPGILNTILHANGDYSDLITAKSGVWERESVPHLHMYGKEVFKLAVTKLGEIVDEIIEKS 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW +PHQAN RII +   ++ +P ++VI+T++ HGNTSAASIPLAL  AV+ G
Sbjct: 234 GLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQHGNTSAASIPLALDAAVRAG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K+GD LLLEA G G   G  LL+
Sbjct: 294 KIKRGDTLLLEAFGAGLAWGAALLK 318


>gi|186475593|ref|YP_001857063.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           phymatum STM815]
 gi|254783793|sp|B2JFI9|FABH_BURP8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|184192052|gb|ACC70017.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           phymatum STM815]
          Length = 329

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 218/329 (66%), Gaps = 15/329 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S V G G  LP   +SN DL     +  ++TSD WI  R GI  RH A  D TT+ L   
Sbjct: 8   SRVLGTGSYLPPNRVSNQDLAARLAKQGIETSDEWIVARTGIHARHFAEPDVTTSDLALI 67

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKR-GFAFDMQAVCSGFV 117
           A++ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVCSGF 
Sbjct: 68  ASQRAIEAADVDPQAIDLIIVATSTPDFVFPSTACLLQNKLGIKNNGAAFDVQAVCSGFA 127

Query: 118 YAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSM 177
           YAV TADS+IRSG  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA++L+  +      
Sbjct: 128 YAVATADSFIRSGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVVLQASD------ 181

Query: 178 ADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVF 235
            + G+L++ L +DGS+ + L   G  +     G   + M+G+AVFK AV    ++  +  
Sbjct: 182 -EPGVLASALHADGSHSNILCTPGNVNGGIVQGSAFLHMDGQAVFKLAVNVLEKVAVEAL 240

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
               L  E IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLAL VAV
Sbjct: 241 QKADLQPEQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVHEHGNTSAASIPLALDVAV 300

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR+++G  +L+E +GGGFT G  ++R+
Sbjct: 301 RDGRIQRGHNVLIEGVGGGFTWGASVIRY 329


>gi|167563541|ref|ZP_02356457.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           oklahomensis EO147]
          Length = 329

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 215/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N DL     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQDLADRLAKDGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKR-GFAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVC+G
Sbjct: 66  LVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNNGAAFDVQAVCAG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+T AD+ IR+G  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYAMTIADTLIRAGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGIIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKADLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GRVK+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRVKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|296136829|ref|YP_003644071.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thiomonas intermedia
           K12]
 gi|295796951|gb|ADG31741.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thiomonas intermedia
           K12]
          Length = 325

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 158/328 (48%), Positives = 210/328 (64%), Gaps = 14/328 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G +LP R +SN +L     +  V+TSD WI  R GI  RH A +  T+  LGE 
Sbjct: 5   SRISGTGSALPPRKVSNDELAADLAQRGVETSDAWIVARTGIRFRHFAEEGTTSVDLGEQ 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A +   DI LIIVATSTPD  FPS A  IQ RLG   G AFD+QAVC+GFVY
Sbjct: 65  AARRALESAGLQAHDIGLIIVATSTPDMIFPSNAALIQGRLGAAGGAAFDVQAVCAGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD ++RSG+ R  +VIG++ FS+I+D++DR+TCVLFGDGAGA++L   E       
Sbjct: 125 ALTVADQFVRSGMTRHALVIGAEVFSQILDFNDRTTCVLFGDGAGAVVLSASEAP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFD 236
             G+L++ L +DG     L   G  S  +  G   ++M+G+AVFK AV    ++  +   
Sbjct: 180 --GVLASALHADGRQSSILCTPGRVSNGQVAGSPFLKMDGQAVFKQAVHVLEDVAREALA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
                  ++DW VPHQAN RI+     K+ IP DK++VTVD HGNTSAASIPLAL VAV+
Sbjct: 238 KADRLPADVDWMVPHQANIRIMTHTAKKLGIPLDKIVVTVDQHGNTSAASIPLALDVAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G++++GD LL EA+GGG T G  ++ +
Sbjct: 298 SGQIQRGDTLLFEAVGGGLTWGAAVVDY 325


>gi|319763858|ref|YP_004127795.1| 3-oxoacyl-(acyl-carrier-protein) synthase iii [Alicycliphilus
           denitrificans BC]
 gi|330823878|ref|YP_004387181.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Alicycliphilus
           denitrificans K601]
 gi|317118419|gb|ADV00908.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Alicycliphilus
           denitrificans BC]
 gi|329309250|gb|AEB83665.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Alicycliphilus
           denitrificans K601]
          Length = 326

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 160/328 (48%), Positives = 213/328 (64%), Gaps = 15/328 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R ++N DL +      ++TSD WI  R GI  RH A +D  ++ L   
Sbjct: 5   SRITGTGSWLPPRRVTNDDLVAQLAGQGIETSDEWIVERTGIRARHFAERDVASSDLALE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFA-FDMQAVCSGFV 117
           A+R AL  A     DIDLIIVATSTPD  FPSTA  +Q++LG+  G   FD+QAVCSGFV
Sbjct: 65  ASRRALEAAGREAQDIDLIIVATSTPDMVFPSTAAILQHKLGITNGCPVFDVQAVCSGFV 124

Query: 118 YAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSM 177
           YA+T AD+ I+SG   R +V+GS+ FSRI+D+ DR+TCVLFGDGAGA++LE  +  G   
Sbjct: 125 YALTVADAMIQSGAASRALVVGSEVFSRILDFHDRTTCVLFGDGAGAVVLEASDTPG--- 181

Query: 178 ADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVF 235
               IL++ L +DGS++  L V G     + +G   ++M+G+AVFK AV    +      
Sbjct: 182 ----ILASELHADGSHVGILCVPGNVCGGQVLGDPLLKMDGQAVFKLAVGVLEKAARAAL 237

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
           D   L   +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL  AV
Sbjct: 238 DKAGLKDADIDWLIPHQANIRIMQSTARKLKMSMDKVVVTVDQHGNTSAASIPLALDHAV 297

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           + G+V+ G  ++LE +GGGFT G +LL+
Sbjct: 298 RCGQVRPGQIVMLEGVGGGFTWGAILLK 325


>gi|121605967|ref|YP_983296.1| 3-oxoacyl-(acyl carrier protein) synthase III [Polaromonas
           naphthalenivorans CJ2]
 gi|166971560|sp|A1VRU7|FABH_POLNA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|120594936|gb|ABM38375.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Polaromonas
           naphthalenivorans CJ2]
          Length = 325

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 166/328 (50%), Positives = 216/328 (65%), Gaps = 14/328 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP   L+N+ L +      V+TSD WI  R GI  RH A  D T++ LG  
Sbjct: 5   SRITGTGSYLPPNRLTNAQLAAELAVKGVETSDEWIVERTGIKARHFAAPDVTSSDLGLE 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AA+ A+  A +   DIDLIIVATSTPD  FPS A  +Q++LG+    AFD+QAVCSGFVY
Sbjct: 65  AAKRAIEAAGLQAADIDLIIVATSTPDMVFPSVACILQHKLGIAGCPAFDLQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ I+SG   + +VIG++ FSRI+D+SDR+TCVLFGDGAGA++LE  E       
Sbjct: 125 ALTVADAMIKSGAASKALVIGAEVFSRILDFSDRTTCVLFGDGAGAVVLEASETP----- 179

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL++ L +DG ++  L V G  S  + +G   + M+GKAVFK AV            
Sbjct: 180 --GILASDLHADGKHVGILCVPGHVSGGQVLGSPLLTMDGKAVFKLAVGVLESAARATLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L   +IDW +PHQAN RI++S   K+K+P +K+IVTVD HGNTSAASIPLAL  AV+
Sbjct: 238 KAGLLETDIDWLIPHQANLRIMHSTAKKLKLPLEKLIVTVDEHGNTSAASIPLALDEAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            G+VKKGD L+LE +GGGFT G VLL++
Sbjct: 298 SGKVKKGDILMLEGVGGGFTWGAVLLKY 325


>gi|255659792|ref|ZP_05405201.1| beta-ketoacyl-acyl-carrier-protein synthase III [Mitsuokella
           multacida DSM 20544]
 gi|260847863|gb|EEX67870.1| beta-ketoacyl-acyl-carrier-protein synthase III [Mitsuokella
           multacida DSM 20544]
          Length = 334

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 149/325 (45%), Positives = 211/325 (64%), Gaps = 14/325 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  +P +V++N DLE +VDTSD WI  R GI  R +A KD+ T+ L E AAR A+ +A
Sbjct: 12  GTGWYVPEKVITNEDLEQMVDTSDEWIVERTGIHERRVARKDQPTSDLAERAARMAIENA 71

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +++DLIIVAT TPD+T PSTA  +Q+RLG  +  AFD+ A CSGF YA  TA  +I
Sbjct: 72  GVKAEELDLIIVATMTPDRTIPSTACILQDRLGATKAGAFDLSAACSGFAYAAATACQFI 131

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            +GV R ++V+G++T S+++DW+DR+TC+LFGDGAGA +   VE         G+LS  L
Sbjct: 132 ETGVYRHILVVGAETLSKVLDWTDRNTCILFGDGAGAAVFGPVE------EGYGLLSFDL 185

Query: 188 CSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            SDG+  D L +  G    P T+ ++     CI M+G+AVF++AV+   E +EK      
Sbjct: 186 GSDGAGGDLLDIPAGGSLKPLTAESLLMHENCIHMDGRAVFRFAVKILGETVEKSLARAG 245

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    IDW VPHQAN RII++   ++++P +KVIV +  +GN SAASIP+ALA AV+  R
Sbjct: 246 IEKSEIDWLVPHQANTRIIDAAAKRLELPAEKVIVDIGKYGNMSAASIPVALAEAVQAHR 305

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
            KKGD + L   G G T  + +++W
Sbjct: 306 FKKGDLIALAGFGAGLTWASCIMKW 330


>gi|37679457|ref|NP_934066.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio vulnificus
           YJ016]
 gi|320156790|ref|YP_004189169.1| 3-oxoacyl-(acyl-carrier-protein) synthase KASIII [Vibrio vulnificus
           MO6-24/O]
 gi|34098528|sp|Q8D8G6|FABH1_VIBVU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
           1; AltName: Full=3-oxoacyl-[acyl-carrier-protein]
           synthase III protein 1; AltName: Full=Beta-ketoacyl-ACP
           synthase III 1; Short=KAS III 1
 gi|61212979|sp|Q7M7J9|FABH1_VIBVY RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
           1; AltName: Full=3-oxoacyl-[acyl-carrier-protein]
           synthase III protein 1; AltName: Full=Beta-ketoacyl-ACP
           synthase III 1; Short=KAS III 1
 gi|37198201|dbj|BAC94037.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio vulnificus
           YJ016]
 gi|319932102|gb|ADV86966.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio vulnificus
           MO6-24/O]
          Length = 316

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 217/323 (67%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP ++ +N+DLE +V+TSD WI  R GI  R IA ++ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAAENETVADMGFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I++G+ + V+VIGSDT S+  D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 IADQHIKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDGAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + D L ++           + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 ILSTHIYADGEFGDLLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANGMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+R+
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVRF 316


>gi|15603779|ref|NP_246853.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pasteurella
           multocida subsp. multocida str. Pm70]
 gi|34098694|sp|Q9CJS8|FABH_PASMU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|12722347|gb|AAK03998.1| FabH [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 317

 Score =  291 bits (745), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 208/322 (64%), Gaps = 8/322 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP+ + +N+DLE +VDTSD WI  R GI  R IA   ET A++G  AA++ 
Sbjct: 3   SKILSTGSYLPKHIRTNADLEKMVDTSDEWISERTGIKERRIAEASETVATMGFEAAQNC 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  + M V++IDLI+VAT++    FPSTA  IQ  LG+K   AFD+ A CSGFVYA+T A
Sbjct: 63  LAVSPMDVNEIDLIVVATTSATHAFPSTACQIQKMLGIKDAIAFDVAAACSGFVYALTVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IR+G V++ +VIG+D FSR ++  DR T +LFGDGAGA+ILE  E         GI+
Sbjct: 123 DQFIRTGKVKKALVIGADLFSRALNPEDRGTIILFGDGAGAVILEASE-------QAGII 175

Query: 184 STYLCSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           ST+L + G   + L + +           + M+G A FK AV +   ++E+  ++  L  
Sbjct: 176 STHLHATGESAEVLTLANQARGIESDPAYLEMQGNATFKIAVRELANVVEETLEANQLDK 235

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++IDW VPHQAN RII++   K+ +   +V+VT+D HGNTSA SIP AL  AV++GR+++
Sbjct: 236 KDIDWLVPHQANLRIISATAKKLDMDMSQVVVTLDRHGNTSAGSIPSALDEAVRDGRIQR 295

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  LLLEA GGG T G+ L+R+
Sbjct: 296 GQLLLLEAFGGGLTWGSALVRF 317


>gi|161621302|ref|YP_584576.2| 3-oxoacyl-(acyl carrier protein) synthase III [Cupriavidus
           metallidurans CH34]
          Length = 326

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 213/324 (65%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R ++N+DL     E  ++TSD WI  R GIS R+ A  D T++ L   AA  
Sbjct: 9   GTGSYLPPRRVTNADLAAQLAEKGIETSDEWIVSRSGISARYWAEPDVTSSDLAVKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   DIDLIIVATSTPD  FPS A  +Q +LG+  +  AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRQDIDLIIVATSTPDYVFPSAACLVQQKLGITNQCAAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  + V+VIGS+ FSRI+D++DR+TCVLFGDGAGA++L   +       + G
Sbjct: 129 TADKFIRSGSHKNVLVIGSEVFSRILDFNDRTTCVLFGDGAGAVVLTASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST + SDGS++  L V G  S     G   + M+G+AVFK AV    ++  +   +  
Sbjct: 182 ILSTAMHSDGSHVGILCVPGNVSGGAITGNAFLHMDGQAVFKLAVTVLDKVAREAITAAE 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +  + IDW +PHQAN RI+     K+ +P +++I TV  HGNTSAASIPLAL VAV++GR
Sbjct: 242 MQADEIDWLIPHQANIRIMQGTAKKLGLPSERMIATVHEHGNTSAASIPLALDVAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           +K G  +L+E +GGGFT G VLLR
Sbjct: 302 IKPGQTVLMEGVGGGFTWGAVLLR 325


>gi|302389617|ref|YP_003825438.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermosediminibacter
           oceani DSM 16646]
 gi|302200245|gb|ADL07815.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermosediminibacter
           oceani DSM 16646]
          Length = 328

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 216/332 (65%), Gaps = 15/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ + G+G   P +VL+NSDLE +V+TSD WIK R GIS R IAG+D  T+ +   A+
Sbjct: 1   MKRAGIIGLGSYTPEKVLANSDLEKMVETSDEWIKTRTGISYRRIAGEDTATSDIAVKAS 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A M  +++DLII AT TPD  FPSTA  +Q ++G  R  AFD+ A C+GF+YA+
Sbjct: 61  LKALEKAAMDPEELDLIIGATVTPDMMFPSTACVVQRKIGAFRAAAFDLSAGCTGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T A  +I++G  R +++ G++T S+IVDW DR+TCVLFGDGAGA ++  VE         
Sbjct: 121 TIATQFIKNGTYRNILIFGAETLSKIVDWQDRNTCVLFGDGAGAAVVSEVE-------QG 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIE 232
           GIL + L +DG   D L++  G    P++  TV      I+M G  VFK+AV+       
Sbjct: 174 GILESLLGADGRGTDLLFMPAGGSREPASIETVRERKHYIKMNGNEVFKFAVKIMEVATR 233

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +V +S +LT +++D+ +PHQAN RII++ + ++ IP +KV+V +D +GN SAASIP+AL 
Sbjct: 234 QVVESANLTTDDVDFIIPHQANMRIIDAAIKRLNIPKEKVMVNLDRYGNMSAASIPVALD 293

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV+E R+KKGD +++   G G T G  L+ W
Sbjct: 294 EAVREKRIKKGDKVVVVGFGAGLTWGANLIEW 325


>gi|303256992|ref|ZP_07343006.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderiales
           bacterium 1_1_47]
 gi|302860483|gb|EFL83560.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderiales
           bacterium 1_1_47]
          Length = 328

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 217/329 (65%), Gaps = 15/329 (4%)

Query: 4   STVRGIGLSLPRRVLSN----SDLESI-VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S +   G  LP+R +SN     DL  I V+TSD WI+ R GI +R++A  +E+T  L   
Sbjct: 7   SRIASTGSFLPKRAVSNEELAQDLAKIGVETSDEWIRTRTGIEQRYLASGEESTTYLASE 66

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AA+ AL     S D+IDLIIVAT+TPD  FPSTA  +Q  LG     AFD+QAVCSGF Y
Sbjct: 67  AAKQALEAGGFSPDEIDLIIVATTTPDSVFPSTACQVQAILGASGAGAFDIQAVCSGFAY 126

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS IR+G   RV+VIG++T SR++DW DR+TCVLFGDGAGA++LE  +       
Sbjct: 127 ALSIADSMIRAGSAERVLVIGAETLSRVLDWKDRTTCVLFGDGAGAVVLEKSD------- 179

Query: 179 DTGILSTYLCSDGSY-IDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVF 235
           + GIL++ L +DG+  +  L  D      + VG   IRM+G+ VFK AVEK  E    V 
Sbjct: 180 EPGILASELKADGTRGVHVLAADSHIDGGKVVGDPFIRMDGRLVFKAAVEKMTESARNVL 239

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
              +L   ++D ++PHQAN RI+N + +K+ I  + ++++V+ HGNTSAAS+PLAL  A 
Sbjct: 240 TKANLATNDVDLYIPHQANLRIMNMVREKLGIDEEHLMISVNQHGNTSAASVPLALDKAH 299

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           + G++K+GD +LL+ +GGGFT  +VLL++
Sbjct: 300 RSGKLKRGDLVLLQGVGGGFTWASVLLKF 328


>gi|209517235|ref|ZP_03266080.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           H160]
 gi|209502371|gb|EEA02382.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia sp.
           H160]
          Length = 329

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 164/335 (48%), Positives = 222/335 (66%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S V G G  LP   ++N DL        V+TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   IYSRVLGTGSCLPPNRVTNQDLAERLARQGVETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSG 115
             A++ A+  A++    IDLI+VATSTPD  FPSTA  +QN+LG+K +G AFD+QAVCSG
Sbjct: 66  LIASQRAIEAADIDPQSIDLIVVATSTPDFVFPSTACLLQNKLGIKNQGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YAV T DS IR+G  R  +V+G++TFSRI+D++DR+TCVLFGDGAGA+IL+  +    
Sbjct: 126 FAYAVATVDSLIRTGQHRTALVVGAETFSRILDFNDRTTCVLFGDGAGAVILQASD---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
              + G+L++ + +DGS+ + L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 182 ---EPGVLASAMHADGSHSNILCTPGNVNGGVVAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK      L  E IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----ADLKPEQIDWLIPHQANIRIMQSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+K+G  +L+E +GGGFT G  ++R+
Sbjct: 295 ALDVAVRDGRIKRGQNVLIEGVGGGFTWGASVIRY 329


>gi|262166127|ref|ZP_06033864.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio mimicus
           VM223]
 gi|262025843|gb|EEY44511.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio mimicus
           VM223]
          Length = 316

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 217/323 (67%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA  +ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIRERRIAADNETVADMAFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DID+IIVAT++P  TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAIDMAGIDKNDIDMIIVATTSPSHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SGV + ++VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGVCKNILVIGSDALSKSCDPTDRSTIILFGDGAGAVVI------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG Y D L ++       +   + M G  VFK AV +  +L+    ++ ++ 
Sbjct: 174 ILSTHIHADGEYGDLLSLEVPERGGSSDKWLHMAGNEVFKVAVTQLSKLVVDTLEANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQMLLLEAFGGGFTWGSALVKF 316


>gi|262037549|ref|ZP_06011008.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Leptotrichia
           goodfellowii F0264]
 gi|261748479|gb|EEY35859.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Leptotrichia
           goodfellowii F0264]
          Length = 325

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/331 (44%), Positives = 214/331 (64%), Gaps = 16/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R  + G G  LP +V++N DL   VDT+D WI+ R GI  R IA ++E T+ L   AA 
Sbjct: 1   MRVGILGTGSYLPEKVMTNDDLSKFVDTNDEWIRTRTGIRERRIAAENEATSDLAYKAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+ +A++  ++IDL+IVAT +PD   P+TA  +Q++LG+    AFD+ A C+GFVYA T
Sbjct: 61  KAIENAKIDKNEIDLVIVATMSPDHITPATAAIVQDKLGINAA-AFDLSAACTGFVYAFT 119

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           T  S+++SG+ ++V+VIG++T SRI+DW DR+TCVLFGDGAGA++L  +E       + G
Sbjct: 120 TGYSFVKSGIYKKVLVIGAETMSRILDWEDRTTCVLFGDGAGAVVLGQIE-------NGG 172

Query: 182 ILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEK 233
            ++++L SDGS  + + +  G    P +   +       +M+G  VFK+AV    E +E 
Sbjct: 173 YIASHLVSDGSGAEDVIIPAGGSRNPVSKEEIDKREIYFKMKGSDVFKFAVRAFPETVEN 232

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V    + T +++D F+PHQAN RII SI  + K P DK  V +  +GNTS ASIPLAL  
Sbjct: 233 VLAQGNTTADDVDMFIPHQANIRIIESIAKRFKQPLDKFYVNLQRYGNTSGASIPLALDE 292

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A KEG++KKGD +++   GGG T G++LL W
Sbjct: 293 ANKEGKLKKGDKVVMVGFGGGLTYGSILLEW 323


>gi|93355218|gb|ABF09307.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cupriavidus
           metallidurans CH34]
          Length = 350

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 160/324 (49%), Positives = 213/324 (65%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R ++N+DL     E  ++TSD WI  R GIS R+ A  D T++ L   AA  
Sbjct: 33  GTGSYLPPRRVTNADLAAQLAEKGIETSDEWIVSRSGISARYWAEPDVTSSDLAVKAAER 92

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   DIDLIIVATSTPD  FPS A  +Q +LG+  +  AFD+QAVCSGFVYA+ 
Sbjct: 93  AIEAAGIDRQDIDLIIVATSTPDYVFPSAACLVQQKLGITNQCAAFDLQAVCSGFVYALA 152

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  + V+VIGS+ FSRI+D++DR+TCVLFGDGAGA++L   +       + G
Sbjct: 153 TADKFIRSGSHKNVLVIGSEVFSRILDFNDRTTCVLFGDGAGAVVLTASD-------EPG 205

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST + SDGS++  L V G  S     G   + M+G+AVFK AV    ++  +   +  
Sbjct: 206 ILSTAMHSDGSHVGILCVPGNVSGGAITGNAFLHMDGQAVFKLAVTVLDKVAREAITAAE 265

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +  + IDW +PHQAN RI+     K+ +P +++I TV  HGNTSAASIPLAL VAV++GR
Sbjct: 266 MQADEIDWLIPHQANIRIMQGTAKKLGLPSERMIATVHEHGNTSAASIPLALDVAVRDGR 325

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           +K G  +L+E +GGGFT G VLLR
Sbjct: 326 IKPGQTVLMEGVGGGFTWGAVLLR 349


>gi|158320485|ref|YP_001512992.1| 3-oxoacyl-(acyl carrier protein) synthase III [Alkaliphilus
           oremlandii OhILAs]
 gi|158140684|gb|ABW18996.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Alkaliphilus
           oremlandii OhILAs]
          Length = 331

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 215/332 (64%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +I   + G G  LP + L+N DLE +VDTSD WI  R GIS+R I+     T+ L   AA
Sbjct: 4   LISVGITGTGSCLPEKELTNFDLEKMVDTSDEWIVARTGISKRRISDDRTATSDLATEAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R+A+  A +  ++IDLIIVAT TPD  FPSTA  +Q  LG  +  AFD++A CSGF+Y +
Sbjct: 64  RNAMKEASLVAEEIDLIIVATVTPDHGFPSTACIVQKNLGASKAVAFDIEAACSGFIYGL 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T  + +I++G+ + ++VIG++T S+IVDW DR+TCVLFGDGAGA++L+ V+         
Sbjct: 124 TIGEQFIKTGLYKNILVIGAETLSKIVDWKDRNTCVLFGDGAGAVVLQPVK------EGY 177

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GIL++ L SDG+  D L    G    P+T  TV      ++M+G  VFK+AV   V+   
Sbjct: 178 GILASSLGSDGASGDYLTQPAGGSRIPTTMDTVQNNLHYVKMDGSEVFKFAVRIMVKSAL 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  + + LT+E +D+ +PHQAN RII +   K+K+  +KV V +D +GN SAAS+P+AL 
Sbjct: 238 ETIEKSCLTLEEVDYVIPHQANIRIIEAAAKKLKLTMNKVHVNLDKYGNMSAASVPVALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AVKEG++K G  + L A GGG T G+ ++RW
Sbjct: 298 EAVKEGKIKDGQIITLVAFGGGLTWGSSVIRW 329


>gi|134295151|ref|YP_001118886.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           vietnamiensis G4]
 gi|166971543|sp|A4JCP8|FABH_BURVG RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|134138308|gb|ABO54051.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           vietnamiensis G4]
          Length = 329

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 158/331 (47%), Positives = 214/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AAR A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  YQAARRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKSGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+  ADS+IR G  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E    
Sbjct: 126 FAYAMAMADSFIRGGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVILSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + G+L + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGVLGSALHADGSYSNILCTPGNVNRGVIEGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                +L  E IDW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIP+AL V
Sbjct: 239 ALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPMALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|154707060|ref|YP_001424921.1| 3-oxoacyl-(acyl carrier protein) synthase III [Coxiella burnetii
           Dugway 5J108-111]
 gi|189037889|sp|A9KEA1|FABH_COXBN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|154356346|gb|ABS77808.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Coxiella burnetii
           Dugway 5J108-111]
          Length = 319

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 215/325 (66%), Gaps = 9/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IAGKDETTASLGEAA 59
           M  + ++G+G  +P+++LSN+DLE +V+T+D WI +RVG+  RH IA   + T ++   A
Sbjct: 1   MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANSPDNTTTMAVDA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVY 118
           A+ A+  A +    ID+IIV T+T +  FPSTA  +Q  L ++    AFD+   C+GFVY
Sbjct: 61  AKRAIEMAGIDPAVIDMIIVGTATAEYYFPSTACLVQKHLNLREDIPAFDINGACAGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ AD YIR+G  + ++VIG D+ +++VDW DRSTC+LFGDGAGA+IL+       +  
Sbjct: 121 ALSIADQYIRNGGAKHILVIGVDSLTKVVDWKDRSTCILFGDGAGAVILQ-------AHK 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GIL+T L ++G Y D +    G     +V  + M GK VFK AV K  E+++++ + +
Sbjct: 174 EPGILNTILHANGDYSDLITAKSGVWERESVPHLHMYGKEVFKLAVTKLGEIVDEIIEKS 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW +PHQAN RII +   ++ +P ++VI+T++ HGNTSAASIPLAL  AV+ G
Sbjct: 234 GLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQHGNTSAASIPLALDAAVRAG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K+GD LLLEA G G   G  LL+
Sbjct: 294 KIKRGDTLLLEAFGAGLAWGAALLK 318


>gi|115314900|ref|YP_763623.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118497916|ref|YP_898966.1| 3-oxoacyl-[acyl-carrier protein] synthase III [Francisella
           tularensis subsp. novicida U112]
 gi|134301585|ref|YP_001121553.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|167010385|ref|ZP_02275316.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. holarctica FSC200]
 gi|187931429|ref|YP_001891413.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194323138|ref|ZP_03056922.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. novicida FTE]
 gi|208779676|ref|ZP_03247021.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella novicida
           FTG]
 gi|224457574|ref|ZP_03666047.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254367799|ref|ZP_04983820.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. holarctica 257]
 gi|254368901|ref|ZP_04984914.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica FSC022]
 gi|254371052|ref|ZP_04987054.1| hypothetical protein [Francisella tularensis subsp. tularensis
           FSC033]
 gi|254373268|ref|ZP_04988756.1| hypothetical protein FTCG_00851 [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374728|ref|ZP_04990209.1| hypothetical protein FTDG_00903 [Francisella novicida GA99-3548]
 gi|254875268|ref|ZP_05247978.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|115129799|gb|ABI82986.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. holarctica OSU18]
 gi|118199810|gb|ABK78989.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica]
 gi|118423822|gb|ABK90212.1| 3-oxoacyl-[acyl-carrier protein] synthase III [Francisella novicida
           U112]
 gi|134049362|gb|ABO46433.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|134253610|gb|EBA52704.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. holarctica 257]
 gi|151569292|gb|EDN34946.1| hypothetical protein FTBG_00803 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|151570994|gb|EDN36648.1| hypothetical protein FTCG_00851 [Francisella novicida GA99-3549]
 gi|151572447|gb|EDN38101.1| hypothetical protein FTDG_00903 [Francisella novicida GA99-3548]
 gi|157121822|gb|EDO65992.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica FSC022]
 gi|187712338|gb|ACD30635.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194322502|gb|EDX19982.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. novicida FTE]
 gi|208744637|gb|EDZ90936.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella novicida
           FTG]
 gi|254841267|gb|EET19703.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282159615|gb|ADA79006.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. tularensis NE061598]
 gi|332678632|gb|AEE87761.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Francisella cf.
           novicida Fx1]
          Length = 323

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 206/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|167570701|ref|ZP_02363575.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           oklahomensis C6786]
          Length = 329

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 214/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N DL     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQDLADRLAKDGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKR-GFAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K  G AFD+QAVC+G
Sbjct: 66  LVAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNNGAAFDVQAVCAG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+T AD+ IR+G  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYAMTIADTLIRAGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGIIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                    E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLAL V
Sbjct: 239 ALSKADFAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLALDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GRVK+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRVKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|206559385|ref|YP_002230146.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           cenocepacia J2315]
 gi|206561213|ref|YP_002231978.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           cenocepacia J2315]
 gi|198035423|emb|CAR51299.1| 3-oxoacyl-[acyl-carrier-protein] synthase III 2 [Burkholderia
           cenocepacia J2315]
 gi|198037255|emb|CAR53177.1| 3-oxoacyl-[acyl-carrier-protein] synthase III 1 [Burkholderia
           cenocepacia J2315]
          Length = 329

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 216/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAAGVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSNILCTPGN-VNRGVIDGS-------AFLHMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E IDW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|56708426|ref|YP_170322.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|110670897|ref|YP_667454.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. tularensis FSC198]
 gi|56604918|emb|CAG46006.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. tularensis SCHU S4]
 gi|110321230|emb|CAL09389.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. tularensis FSC198]
          Length = 323

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 206/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMPKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|118199814|gb|ABK78991.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica]
          Length = 319

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 206/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|288818116|ref|YP_003432464.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Hydrogenobacter
           thermophilus TK-6]
 gi|288787516|dbj|BAI69263.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Hydrogenobacter
           thermophilus TK-6]
 gi|308751717|gb|ADO45200.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Hydrogenobacter
           thermophilus TK-6]
          Length = 307

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 210/321 (65%), Gaps = 16/321 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           +T+ GIG  LP +VL+N DLE +VDTSD WI  R GI  R IA  +E    +   A+ +A
Sbjct: 3   TTLTGIGYYLPPKVLTNFDLEKMVDTSDDWITTRTGIKERRIA-DNENVTQMAYMASLEA 61

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  +DIDLII+AT TP+  FPSTA  +Q +LG KR +AFD+ A CSGF+Y +  A
Sbjct: 62  LESANIQPEDIDLIILATLTPELKFPSTACLLQAKLGAKRAYAFDISAACSGFIYGLELA 121

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D+YI+SG  ++++++G +  S IV+W DRSTCVLFGDGAGA+I+        S  D  +L
Sbjct: 122 DAYIKSGKAKKILLVGVEKLSEIVNWQDRSTCVLFGDGAGAVII--------SEGDGEVL 173

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           S+ + SDG   + LY       +   G I M+GK +FK AV    E+   V +S  ++IE
Sbjct: 174 SSKMLSDGELWEILY-------APKCGYINMKGKELFKLAVRSMEEVCRYVLESAGISIE 226

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++   +PHQAN RI+ ++ +K+ +P +KV   +  +GNTSAASIP+A+  A KEG++++G
Sbjct: 227 DVSIMIPHQANIRIMEALAEKLGMPKEKVYSNIHKYGNTSAASIPIAMYEAYKEGKLRRG 286

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D ++L AMGGG T G +LLR+
Sbjct: 287 DIVMLTAMGGGLTWGAMLLRF 307


>gi|171057302|ref|YP_001789651.1| 3-oxoacyl-(acyl carrier protein) synthase III [Leptothrix cholodnii
           SP-6]
 gi|170774747|gb|ACB32886.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Leptothrix cholodnii
           SP-6]
          Length = 330

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 215/330 (65%), Gaps = 17/330 (5%)

Query: 4   STVRGIGLSLPRRVLSNSDL-ESI----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G SLP R LSN+ L E +    ++TSD WI  R GI  RH       ++ L   
Sbjct: 9   SRITGTGSSLPPRRLSNAQLTEELAARGIETSDEWIVERTGIRARHFVDAGVNSSDLAVE 68

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFV 117
           A R A+  A +   DIDLIIVATSTPD  FPS A  +Q +LG+  G  AFD+QAVCSGF+
Sbjct: 69  AGRHAIESAGLQPSDIDLIIVATSTPDMVFPSNACIVQRKLGIVNGAPAFDVQAVCSGFI 128

Query: 118 YAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSM 177
           YA+T AD+ IR+G  R  +VIG++ FSRI+D++DR+TCVLFGDGAGA++L        S 
Sbjct: 129 YAMTMADALIRTGSARNALVIGAEVFSRILDFTDRTTCVLFGDGAGAVVL--------SA 180

Query: 178 ADT-GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKV 234
           +DT GIL+T + +DG +++ L V G  S  + +G   ++M+G+AVFK AV         V
Sbjct: 181 SDTPGILATDMHADGRHVEILCVPGTVSGGQILGDPLLKMDGQAVFKLAVGVLESAARAV 240

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                    +IDW +PHQAN RI++    K+K+P DK+IVTVD HGNTSAASIPLAL  A
Sbjct: 241 LAKAGKDSSDIDWLIPHQANIRIMHGTARKLKLPLDKLIVTVDEHGNTSAASIPLALDQA 300

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V+ GRV++G  L+LE +GGGFT G VL+ +
Sbjct: 301 VRSGRVQRGQTLMLEGVGGGFTWGAVLVEF 330


>gi|261493143|ref|ZP_05989678.1| hypothetical protein COK_1556 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261495788|ref|ZP_05992224.1| hypothetical protein COI_1551 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261308553|gb|EEY09820.1| hypothetical protein COI_1551 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261311198|gb|EEY12366.1| hypothetical protein COK_1556 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 323

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 211/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S +   G  LP +V +N+DLE +VDTSD WI  R GI  R IA  DET A++G  AA+
Sbjct: 8   MNSRILATGSYLPTKVRTNADLEKMVDTSDEWIVTRSGIRERRIAEPDETVATMGAKAAQ 67

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  +DIDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA+T
Sbjct: 68  QALEMAGIEANDIDLIVVGTTTNSHAYPSAACQIQGLLQIEDAIAFDVAAACTGFVYALT 127

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++R+G V++ +VIGSD  SR++D +DRST VLFGDGAGA+ILE  E       + G
Sbjct: 128 VADQFVRNGQVKKALVIGSDINSRMLDETDRSTVVLFGDGAGAVILEASE-------EPG 180

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L +     + L +          G I M+G A FK AV +   ++E+  ++ +L 
Sbjct: 181 IISTHLHASPDLENNLTLRSQKRGEERSGFIEMQGNATFKIAVNQLSSVVEETLEANNLQ 240

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW +PHQAN RII +   K+++  D+V+VT+D + NTS A++P+AL  AV++GR++
Sbjct: 241 KSDLDWLIPHQANLRIITATAKKLEMEMDQVVVTLDKYANTSGATVPVALDEAVRDGRIQ 300

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGG+T G+VL+++
Sbjct: 301 RGQLLLLEAFGGGWTWGSVLVKF 323


>gi|238650589|ref|YP_002916441.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia peacockii
           str. Rustic]
 gi|238624687|gb|ACR47393.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia peacockii
           str. Rustic]
          Length = 318

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 212/318 (66%), Gaps = 7/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDTEYTSHLALKSAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SV+DIDLII+ T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISVNDIDLIIICTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            S   + +++IG++  + ++DW+DR+TCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 SSDKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGS-YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            S G+ Y + LY +GG S +   G I M+G+ +F++A+EK  + I+ +  +   ++ +ID
Sbjct: 181 FSSGADYDEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQQSIKDLLHANQFSVSDID 240

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           +F+PHQAN RIIN + + + I   KV+ TVD H N SAASIPLAL+     G++KKGD L
Sbjct: 241 YFIPHQANIRIINKLAELLNIEEHKVVKTVDKHANCSAASIPLALSTLKASGKIKKGDIL 300

Query: 307 LLEAMGGGFTSGTVLLRW 324
           L  A+G G T G+  +RW
Sbjct: 301 LFSAIGAGLTWGSAFIRW 318


>gi|260776335|ref|ZP_05885230.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607558|gb|EEX33823.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 316

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V SN+DLE +VDTSD WI  R GI  R IA ++ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQVRSNADLEKMVDTSDEWIVTRTGIKERRIAAENETVADMGYIAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +L +K   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLDIKGCPAFDIAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++++G+ + V+VIGSDT S+  D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 VADQHVKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDGAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ SDG + + L ++           + M G  VFK AV +  +L++    +  + 
Sbjct: 174 ILSTHIYSDGRFGELLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLAANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|188534156|ref|YP_001907953.1| 3-oxoacyl-(acyl carrier protein) synthase III [Erwinia tasmaniensis
           Et1/99]
 gi|188029198|emb|CAO97070.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Erwinia tasmaniensis
           Et1/99]
          Length = 317

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 210/325 (64%), Gaps = 14/325 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  A
Sbjct: 3   SKIIGTGSYLPEQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGPDETVATMGFQAASRA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  + +  +DI LI+VAT++    FPS+A  IQ  L +    +FD+ A C+GF YA++ A
Sbjct: 63  LEMSGIDKNDIGLIVVATTSSSHAFPSSACMIQQMLEIDDAASFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D YI++GVV+  +VIG+D  +R++D +DR T +LFGDGAGA++LE  E       + GI+
Sbjct: 123 DQYIKNGVVKNALVIGADVLARMLDPNDRGTIILFGDGAGAVVLEASE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ST+L +DG Y   L +   P+  R        + M G  VFK AV +   ++E+   + +
Sbjct: 176 STHLHADGRYGQLLTL---PNQDRENQENPSYVTMAGNEVFKVAVTELAHIVEETLQANN 232

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L    IDW VPHQAN RIIN+   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR
Sbjct: 233 LDRAAIDWLVPHQANLRIINATARKLGMDMDKVVVTLDRHGNTSAASVPTALDEAVRDGR 292

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G  +LLEA GGGFT G+ L+R+
Sbjct: 293 IQRGQLVLLEAFGGGFTWGSALVRF 317


>gi|42523489|ref|NP_968869.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Bdellovibrio
           bacteriovorus HD100]
 gi|39575695|emb|CAE79862.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Bdellovibrio
           bacteriovorus HD100]
          Length = 331

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 208/332 (62%), Gaps = 12/332 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M RS V GIG  LP ++LSN DLE +V+T+D WI  R GI RRHIA +D+ T+ L   AA
Sbjct: 4   MYRSRVSGIGSYLPEKILSNKDLEKMVETNDQWIVERTGIERRHIASEDQATSDLCVIAA 63

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A + V+DID+I+V T T D   PSTA  +Q +LG K   A D+ A CSGF+Y V
Sbjct: 64  KRALEDANLKVEDIDMILVGTVTGDHQMPSTACFVQAKLGAKNIMAVDLNAACSGFLYGV 123

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +IR+G+ + ++VIG++  SR +++ DR TC+LFGDGAGA ++     + +     
Sbjct: 124 SIADQFIRTGMYKNILVIGAEVLSRYMNYKDRETCILFGDGAGAWVMS----RAAEGQTN 179

Query: 181 GILSTYLCSDGSYIDKLYVDGGPST--------SRTVGCIRMEGKAVFKYAVEKAVELIE 232
            I S++L +DG+  D L +  G S          + +  + M+G+ +FK AV       +
Sbjct: 180 VIESSHLRADGTLADLLILPAGGSKIPQSHEAIDKGLNFMTMKGRDIFKNAVRTMASCCQ 239

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  +   +  E +DW VPHQAN RII ++ D+ K P ++VIV +   GNTSAASIPLA  
Sbjct: 240 EALEHNKVAPEQVDWIVPHQANKRIIEAVADQFKFPMERVIVYLQETGNTSAASIPLAFD 299

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AVK G++K+G  +LL A G G TSG++LLR+
Sbjct: 300 WAVKNGKIKRGQTILLTAFGAGLTSGSILLRY 331


>gi|89256465|ref|YP_513827.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica LVS]
 gi|89144296|emb|CAJ79580.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica LVS]
          Length = 323

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 206/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 THQIKPGDTIISEAFGAGFVWG 317


>gi|254362210|ref|ZP_04978325.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Mannheimia haemolytica
           PHL213]
 gi|153093782|gb|EDN74721.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Mannheimia haemolytica
           PHL213]
          Length = 316

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 211/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S +   G  LP +V +N+DLE +VDTSD WI  R GI  R IA  DET A++G  AA+
Sbjct: 1   MNSRILATGSYLPTKVRTNADLEKMVDTSDEWIVTRSGIRERRIAEPDETVATMGAKAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +  +DIDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA+T
Sbjct: 61  QALEMAGIEANDIDLIVVGTTTNSHAYPSAACQIQGLLQIEDAIAFDVAAACTGFVYALT 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++R+G V++ +VIGSD  SR++D +DRST VLFGDGAGA+ILE  E       + G
Sbjct: 121 VADQFVRNGQVKKALVIGSDINSRMLDETDRSTVVLFGDGAGAVILEASE-------ELG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L +     + L +          G I M+G A FK AV +   ++E+  ++ +L 
Sbjct: 174 IISTHLHASPDLENNLTLRSQKRGEERSGFIEMQGNATFKIAVNQLSSVVEETLEANNLQ 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
             ++DW +PHQAN RII +   K+++  D+V+VT+D + NTS A++P+AL  AV++GR++
Sbjct: 234 KSDLDWLIPHQANLRIITATAKKLEMEMDQVVVTLDKYANTSGATVPVALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGG+T G+VL+++
Sbjct: 294 RGQLLLLEAFGGGWTWGSVLVKF 316


>gi|57339706|gb|AAW49840.1| hypothetical protein FTT1373 [synthetic construct]
          Length = 358

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 206/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 29  AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 88

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 89  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 148

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 149 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 201

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 202 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 261

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 262 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMPKVVTTLQDHGNTSAASIPLALDHAVR 321

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 322 TNQIKPGDTIISEAFGAGFVWG 343


>gi|238791861|ref|ZP_04635498.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia intermedia
           ATCC 29909]
 gi|238728965|gb|EEQ20482.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia intermedia
           ATCC 29909]
          Length = 317

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 207/326 (63%), Gaps = 12/326 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA 
Sbjct: 1   MYTKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVATMGFHAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +S D I LI+VAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++
Sbjct: 61  KALEMAGVSKDQIGLIVVATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD Y++SG V+  +VIGSD  SR +D  DR T +LFGDGAGA++L   E       + G
Sbjct: 121 VADQYVKSGAVKHAIVIGSDMLSRALDPEDRGTIILFGDGAGAVVLGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKL---YVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           ILST+L +DGSY   L   Y D           + M G  VFK AV +   ++++   + 
Sbjct: 174 ILSTHLHADGSYGQLLALPYQD--RQQQEQPAYVTMAGNEVFKVAVTELAHIVDETLQAN 231

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           +L    +DW VPHQAN RII +   K+ +  DKV++T+D HGNTSAAS+P AL  AV++G
Sbjct: 232 NLERTALDWLVPHQANLRIITATAKKLGMGMDKVVITLDRHGNTSAASVPAALDEAVRDG 291

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+++G  +LLEA GGGFT G+ L+R+
Sbjct: 292 RIQRGQLVLLEAFGGGFTWGSALVRF 317


>gi|251772096|gb|EES52666.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Leptospirillum
           ferrodiazotrophum]
          Length = 332

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 214/325 (65%), Gaps = 8/325 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ V G G   P RV++N D  + ++TSD WI+ R GI  R IA ++E+T+ L   AA+
Sbjct: 4   LRAVVTGTGSYAPSRVMTNDDFAAYLETSDSWIRERTGIRERRIAAEEESTSDLAVFAAQ 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  + +S  DID I++AT+TPD  FPSTA  +Q RLG  R FAFD+ AVCSGFVYA+T
Sbjct: 64  KALESSGLSASDIDGILLATATPDILFPSTACLVQARLGATRAFAFDLNAVCSGFVYAMT 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A S + +G   R++V+GS+  SR +DWSDRST +LFGDGAGA+++E      S++A  G
Sbjct: 124 VAKSLVETGAASRLLVVGSEVMSRSLDWSDRSTAILFGDGAGAVVVE-----ASTVASRG 178

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           + S  L +DG + + ++V GG  T RT     IRM+G   FK AV +  E + +V     
Sbjct: 179 LGSFRLGADGRHWEMIHVPGG-GTRRTEAPHTIRMKGGETFKMAVRQLQESVLEVLALDG 237

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L   +ID  VPHQAN RII+++  ++ +P +KV+V +D +GNTSAASIP+AL  AV+ GR
Sbjct: 238 LAPADIDLLVPHQANIRIIDALASRLSLPPEKVMVNIDRYGNTSAASIPVALDEAVRGGR 297

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           V +GD +LL A G G T G+ LL W
Sbjct: 298 VAEGDRILLTAFGAGVTWGSGLLTW 322


>gi|323702691|ref|ZP_08114352.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Desulfotomaculum
           nigrificans DSM 574]
 gi|323532354|gb|EGB22232.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Desulfotomaculum
           nigrificans DSM 574]
          Length = 337

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 214/332 (64%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           ++++ + G+G  +P R+L+N DLE +VDTSD WI  R GI  R IA  +E+T+ L   AA
Sbjct: 5   LVQAGIIGVGSYVPERILTNKDLEKMVDTSDEWITSRTGIKERRIADPEESTSELAVKAA 64

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL HA +  +++DLII+AT T D  FP++A  +Q++LG     AFD++A C+GFVYA+
Sbjct: 65  RRALAHAGVKPEELDLIILATCTKDMPFPASACLVQDQLGAVNAGAFDIEAGCTGFVYAL 124

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           T    ++ +G ++RV+VIG+D  S++ +W DR+TCVLFGDGAGA++L      G      
Sbjct: 125 TVGSQFVATGSMKRVLVIGADNLSKVTNWEDRNTCVLFGDGAGAVVL------GPVAPGE 178

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIE 232
           GIL++ L ++G+    L +  G    P++  TV      I M+G+ VF+YAV+   E   
Sbjct: 179 GILASKLAAEGAGWKYLSMPAGGSRMPASPLTVEKKLHYIHMQGREVFRYAVKVMEEEAA 238

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
            +  +  L + +ID  +PHQAN RII     K+K+  DKV+V VD +GNTS ASIPLAL 
Sbjct: 239 NIVKAAGLALSDIDLLIPHQANIRIIEHAAKKLKLSMDKVVVNVDRYGNTSTASIPLALD 298

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AVK GRVK GD +++ A G G TSG ++L+W
Sbjct: 299 EAVKSGRVKAGDNIVMVAFGAGLTSGAIVLKW 330


>gi|78222809|ref|YP_384556.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Geobacter
           metallireducens GS-15]
 gi|78194064|gb|ABB31831.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Geobacter
           metallireducens GS-15]
          Length = 326

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/332 (44%), Positives = 216/332 (65%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+ + G G ++P  + +N DLE +VDT+D WI  R GI  R IA + E T++    AA
Sbjct: 1   MARARIIGTGSAVPEMIRTNFDLEKMVDTTDDWITTRTGIRERRIAAEGEYTSTFATRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A ++ ++IDL+IVAT TPD  FPSTA  +Q+ +G KR  AFD+ A CSGF+Y +
Sbjct: 61  ERALEMAGVTAEEIDLLIVATVTPDFPFPSTACIVQSNIGAKRAAAFDVSAACSGFLYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+ IRSG   + ++IG++  SR++DW+DR+TC+LFGDG+GA+++E  E      ++ 
Sbjct: 121 SLADNAIRSGGASKALIIGAEVLSRVIDWTDRNTCLLFGDGSGAVVVEACE------SEQ 174

Query: 181 GILSTYLCSDGSYIDKLYVDG----GPSTSRTV----GCIRMEGKAVFKYAVEKAVELIE 232
           G+LST+L SDGSY + LY  G     P+  +T+      +RM+G  VFK AV    +   
Sbjct: 175 GVLSTHLHSDGSYWELLYQPGCGNRNPAVQKTLDERKNFLRMQGNEVFKLAVRAMEDAAL 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  +   LT  +I  F+PHQAN RII++I  ++ +  DKV V +D +GNTS+ASIPLAL 
Sbjct: 235 QALEKNGLTPSDISIFIPHQANRRIIDAIGKRLGLSDDKVYVNLDRYGNTSSASIPLALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + GR+ +GD +L +A GGG T  +VLLRW
Sbjct: 295 EANRGGRINEGDIVLFDAFGGGLTWASVLLRW 326


>gi|116689143|ref|YP_834766.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           cenocepacia HI2424]
 gi|170732431|ref|YP_001764378.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           cenocepacia MC0-3]
 gi|254245924|ref|ZP_04939245.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Burkholderia cenocepacia PC184]
 gi|166971537|sp|A0K5U6|FABH_BURCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|254783792|sp|B1JYA0|FABH_BURCC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|116647232|gb|ABK07873.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           cenocepacia HI2424]
 gi|124870700|gb|EAY62416.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Burkholderia cenocepacia PC184]
 gi|169815673|gb|ACA90256.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           cenocepacia MC0-3]
          Length = 329

 Score =  290 bits (741), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 216/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAAGVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +++G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALIVGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSNILCTPGN-VNRGVIDGS-------AFLHMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E IDW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|29653835|ref|NP_819527.1| 3-oxoacyl-(acyl carrier protein) synthase III [Coxiella burnetii
           RSA 493]
 gi|34098442|sp|Q820X0|FABH_COXBU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|29541098|gb|AAO90041.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Coxiella burnetii
           RSA 493]
          Length = 319

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 215/325 (66%), Gaps = 9/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IAGKDETTASLGEAA 59
           M  + ++G+G  +P+++LSN+DLE +V+T+D WI +RVG+  RH IA   + T ++   A
Sbjct: 1   MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANSPDNTTTMAVDA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVY 118
           A+ A+  A +    ID+IIV T+T +  FPSTA  +Q  L ++    AFD+ A C+GFVY
Sbjct: 61  AKRAIEMAGIDPAVIDMIIVGTATAEYYFPSTACLVQKHLNLREDIPAFDINAACAGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ AD YIR+   + ++VIG D+ +++VDW DRSTC+LFGDGAGA+IL+       +  
Sbjct: 121 ALSIADQYIRNEGAKHILVIGVDSLTKVVDWKDRSTCILFGDGAGAVILQ-------AHK 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GIL+T L ++G Y D +    G     +V  + M GK VFK AV K  E+++++ + +
Sbjct: 174 EPGILNTILHANGDYSDLITAKSGVWERESVPHLHMYGKEVFKLAVTKLGEIVDEIIEKS 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L   +IDW +PHQAN RII +   ++ +P ++VI+T++ HGNTSAASIPLAL  AV+ G
Sbjct: 234 GLKQSDIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQHGNTSAASIPLALDAAVRAG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K+GD LLLEA G G   G  LL+
Sbjct: 294 KIKRGDTLLLEAFGAGLAWGAALLK 318


>gi|171463184|ref|YP_001797297.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Polynucleobacter
           necessarius subsp. necessarius STIR1]
 gi|254783819|sp|B1XTK6|FABH_POLNS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|171192722|gb|ACB43683.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Polynucleobacter
           necessarius subsp. necessarius STIR1]
          Length = 328

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 214/333 (64%), Gaps = 17/333 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I + V G G  LP   L+N DL     ++ ++TSD WIK R GIS RH A ++E T+ L 
Sbjct: 3   IFARVAGTGSYLPELRLTNQDLVERLAKTGLETSDEWIKTRSGISARHFAAENELTSDLA 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQT--FPSTAVNIQNRLGMKRGFA-FDMQAVC 113
             AA  AL    ++  D+DLII+ATSTPD    FPSTA  +Q++LG     A FD+QAVC
Sbjct: 63  VRAAEAALSSTGINSADLDLIILATSTPDHLGGFPSTACVVQDKLGAHTSCAAFDVQAVC 122

Query: 114 SGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVK 173
           +GF YA+  AD++IRSG  ++V+VIG++TFSRI+++ DR TCVLFGDGAGA++LE  +  
Sbjct: 123 AGFTYALAVADAFIRSGSYKKVLVIGAETFSRILNFQDRGTCVLFGDGAGAVVLEASK-- 180

Query: 174 GSSMADTGILSTYLCSDGSYIDKLYVDG--GPSTSRTVGCIRMEGKAVFKYAVEKAVELI 231
                + GILST + +DGS  D L V G  G    R    + M+G+AVFK AV+   ++ 
Sbjct: 181 -----EAGILSTVMHADGSQRDILCVPGRAGNGEVRGSPFMTMDGQAVFKLAVKVLEQVA 235

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
            +  D   L  E IDW VPHQAN RI+     KM +  DKVIVTV  HGNTSAASIPLAL
Sbjct: 236 HEALDKAKLKPEQIDWLVPHQANIRIMEGTAKKMGMSMDKVIVTVHEHGNTSAASIPLAL 295

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
              V+ G++K+G  LLLE +GGGF  G V +++
Sbjct: 296 DSGVRSGQIKRGQHLLLEGVGGGFAWGAVAIKY 328


>gi|107022197|ref|YP_620524.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           cenocepacia AU 1054]
 gi|122979066|sp|Q1BXV4|FABH_BURCA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|105892386|gb|ABF75551.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           cenocepacia AU 1054]
          Length = 329

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/331 (47%), Positives = 214/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAAGVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IRSG  R  +++G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E    
Sbjct: 126 FAYAMATADSFIRSGQHRTALIVGAETFSRILDFKDRTTCVLFGDGAGAVILSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCI--RMEGKAVFKYAVEKAVELIEK 233
              + G+L + L +DGSY + L   G  +     G +   M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGVLGSALHADGSYSNILCTPGNVNRGVIDGSVFLHMDGQAVFKLAVNVLEKVAIE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                +L  E IDW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL  
Sbjct: 239 ALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALDA 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|134299921|ref|YP_001113417.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Desulfotomaculum
           reducens MI-1]
 gi|134052621|gb|ABO50592.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Desulfotomaculum
           reducens MI-1]
          Length = 335

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 145/332 (43%), Positives = 212/332 (63%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IR+ + G+G  +P R+L+N +LE IVDTSD WIK R GI  R IA   ++T+ L   A+
Sbjct: 5   LIRAGILGVGSYVPERILTNKELEKIVDTSDEWIKSRTGIKERRIAEPGKSTSDLATIAS 64

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL HA +  +++DLII+ T + D   P+ A  +Q  LG  +  AFD++A CSGFVY +
Sbjct: 65  RRALEHAGIKPEELDLIILTTCSKDMIIPAGACLVQQELGATKAGAFDLEAGCSGFVYGL 124

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A  +I +G ++ V+VIGS+  S++V+W DR+TCVLFGDGAGA+++      G   +D 
Sbjct: 125 SIATQFIATGAMKHVLVIGSEVLSKVVNWDDRNTCVLFGDGAGAVVV------GPVSSDE 178

Query: 181 GILSTYLCSDGSYIDKLYVDGGPS--------TSRTVGCIRMEGKAVFKYAVEKAVELIE 232
           G+L++ L ++G+  + LY+  G S          + +  I M GK VF+YAV    E   
Sbjct: 179 GVLASKLSAEGAGWEHLYIPAGGSKMPADPVTVEKKLHYIHMNGKEVFRYAVRVMEEASL 238

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
            +  + +L + +ID  +PHQAN RII     K+++P DKV V +D +GNTS+ASIP+ALA
Sbjct: 239 TLLKAANLELSDIDLLIPHQANMRIIEHAAKKLRLPMDKVAVNLDRYGNTSSASIPIALA 298

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV  GRVK GD L++ A G G TSG V+L+W
Sbjct: 299 EAVHSGRVKAGDNLVMVAFGAGLTSGGVVLKW 330


>gi|258625448|ref|ZP_05720341.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio mimicus VM603]
 gi|258582252|gb|EEW07108.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio mimicus VM603]
          Length = 316

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 217/323 (67%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA  +ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIRERRIAADNETVADMAFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DID+IIVAT++P  TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAIDMAGIDKNDIDMIIVATTSPSHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SGV + ++VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGVCKNILVIGSDALSKSCDPTDRSTIILFGDGAGAVVI------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG Y D L ++       +   + M G  VFK AV +  +L+    ++ ++ 
Sbjct: 174 ILSTHIHADGEYGDLLSLEVPERGGSSDKWLHMAGNEVFKVAVTQLSKLVVDTLEANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              ++W VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELNWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQMLLLEAFGGGFTWGSALVKF 316


>gi|237745499|ref|ZP_04575979.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Oxalobacter
           formigenes HOxBLS]
 gi|229376850|gb|EEO26941.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Oxalobacter
           formigenes HOxBLS]
          Length = 328

 Score =  289 bits (740), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 219/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I   + G G  LP + ++N +L ++     V+TSD WI+ R GI  RH A +   ++ LG
Sbjct: 3   IYGKIIGTGSYLPPKRVTNDELAAMLAERGVETSDEWIRTRSGILARHYADQGVNSSDLG 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPD--QTFPSTAVNIQNRLGMKRGFA-FDMQAVC 113
             AA  AL  A+   +DI+LIIVATSTPD    FPSTA  +Q +LG+    A FDMQAVC
Sbjct: 63  AKAAGKALEMAKCEANDIELIIVATSTPDFLGGFPSTACMVQKKLGITSNCAAFDMQAVC 122

Query: 114 SGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVK 173
           SGF+YA++ ADS+IR+GV R+V+V+G++T+SRI+D+ DR+TCVLFGDGAGA++L      
Sbjct: 123 SGFLYALSVADSFIRAGVYRKVLVVGAETYSRIIDYQDRTTCVLFGDGAGAVVL------ 176

Query: 174 GSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELI 231
            S+  + GILST L +DG Y D L + G  +     G   + M+GKAVFK AV    ++ 
Sbjct: 177 -SASDEPGILSTALHADGHYGDILSLPGKLNNGAIEGKAFVYMDGKAVFKLAVTWLDKVG 235

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
            +  +   L   ++DW VPHQAN RI+ S   K+ IP +K+IVTVD HGNTSAASIPLA+
Sbjct: 236 MEALEKAGLKNTDVDWMVPHQANLRIMQSSAKKLDIPSEKIIVTVDQHGNTSAASIPLAI 295

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
              V++GR+K G  LLL A+GGG T G VL++
Sbjct: 296 DTGVRDGRIKAGQNLLLAAIGGGLTWGAVLVK 327


>gi|332184450|gb|AEE26704.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Francisella cf.
           novicida 3523]
          Length = 323

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 205/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCANETETTSYMATQAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ ++ID IIVATSTPD   PSTA  I   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANEIDTIIVATSTPDFIMPSTASMIHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV R ++V+G++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSRNILVVGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQSINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 DAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|239946699|ref|ZP_04698452.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239920975|gb|EER20999.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 317

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 211/317 (66%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDTEYTSHLALKSAEKAIVDA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +S +DIDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISANDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DR+TCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 SSGKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            + G+  + LY +GG S +   G I M+G+ +F++A+EK  + I+ +  +   ++ +ID+
Sbjct: 181 FTSGADYEILYTNGGISMNGISGKIVMQGQKLFRHAIEKMQQSIKDLLHANQFSVSDIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + +   KVI T++ H N SAASIPLAL+     G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAESLNLSEHKVIKTLEKHANCSAASIPLALSTLKASGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ L+RW
Sbjct: 301 FSAIGAGLTWGSALIRW 317


>gi|328474611|gb|EGF45416.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio
           parahaemolyticus 10329]
          Length = 316

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQGKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ +DG + D L +            + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 IISTHIYADGQFGDLLSLPVPERGKDVDKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|312882461|ref|ZP_07742202.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369861|gb|EFP97372.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP ++ +N+DLE +VDTSD WI  R GI  R IA K+ET A +G  AA 
Sbjct: 1   MYSKILGTGSYLPSQIRTNADLEKMVDTSDEWIVARTGIRERRIADKNETVAEMGYLAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A +  +DIDL+IVAT++    FPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  KAIEMAGIDRNDIDLVIVATTSGSHNFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++++G+ + V+VIG+D  S++ D +DRST +LFGDGAGA+++      G S  + G
Sbjct: 121 VADQHVKTGMCKNVLVIGADVLSQLCDPTDRSTIILFGDGAGAMVV------GQS-DEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ SDG + + L  +       T   + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 ILSTHIYSDGRFGELLSAEAPKRGEDTDKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA+IP A+  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATIPTAMDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|225180927|ref|ZP_03734375.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dethiobacter
           alkaliphilus AHT 1]
 gi|225168408|gb|EEG77211.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dethiobacter
           alkaliphilus AHT 1]
          Length = 327

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 143/327 (43%), Positives = 214/327 (65%), Gaps = 15/327 (4%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + GIG +LP ++++N DLE IVDT+D WI+ R GI  R +A + E T+ L   AA+ AL 
Sbjct: 8   ILGIGSALPDKIVTNVDLEKIVDTNDEWIRTRTGICERRVAAEGEHTSDLAARAAQKALD 67

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +SVD++DLII+AT+TPD   PSTA ++Q ++G  R  AFD+ AVC+GF+Y +     
Sbjct: 68  DAGISVDEVDLIILATATPDSPMPSTACHVQAKIGATRAAAFDLSAVCTGFIYGLAVGSQ 127

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           ++ +GV +RV+VIG++  SRI+DWSDRSTCVLFGDGAGA++L   E +       G+LS 
Sbjct: 128 FVATGVYKRVLVIGAEVLSRILDWSDRSTCVLFGDGAGAVVLGPREAE-------GLLSF 180

Query: 186 YLCSDGSYIDKLYVDGG----PSTSRT----VGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
            L SDG+  + L++  G    P+T +T    +  ++M G  ++K+AV    E+ ++  D+
Sbjct: 181 KLGSDGTTANLLHIPAGGTCQPATPQTLEDRLHYVKMSGNEIYKFAVRAMGEVTQEALDA 240

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +  +++D  VPHQANWRII +   +  +P D+V+V +D +GN S+ASIP+AL  A + 
Sbjct: 241 AGVDKKDLDLLVPHQANWRIIEAARKRFDVPEDRVVVNIDRYGNMSSASIPVALDEAYRS 300

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+ +GD L L   G G T G  +LR+
Sbjct: 301 GRLNRGDLLALVGFGAGLTWGAAVLRY 327


>gi|271500130|ref|YP_003333155.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dickeya dadantii
           Ech586]
 gi|270343685|gb|ACZ76450.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Dickeya dadantii
           Ech586]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 207/321 (64%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++ +N+DLE +VDTSD WI  R GI  R IA  DE+ AS+G  AA++A
Sbjct: 3   TKILGTGSYLPEQIRTNADLEKMVDTSDEWIVTRTGIRERRIAAPDESVASMGYRAAQNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +    + L+IVAT++    FPS+A  IQ  LG+K   AFD+ A C+GF YA++ A
Sbjct: 63  LDMAGIDQSQVGLLIVATTSSSHAFPSSACQIQQMLGIKDTIAFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D Y++SG V   +VIGSD  SR +D +DR T +LFGD AGA++L      G S  + GIL
Sbjct: 123 DQYVKSGAVEYALVIGSDALSRTLDPADRGTLILFGDAAGAVVL------GRSQ-EAGIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +DG Y + L +      +     + M G  VFK AV +   ++E+  D++ L   
Sbjct: 176 STHLHADGRYGELLALPYSDRQAPEPAYLTMAGNEVFKVAVTELAHIVEETLDASGLDKS 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            IDW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+++G
Sbjct: 236 KIDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIQRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 296 QLILLEAFGGGFTWGSALIRF 316


>gi|118199817|gb|ABK78992.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica]
          Length = 323

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 205/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+  P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDRPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|28898830|ref|NP_798435.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260879496|ref|ZP_05891851.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein 1 [Vibrio
           parahaemolyticus AN-5034]
 gi|34098478|sp|Q87N20|FABH1_VIBPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
           1; AltName: Full=3-oxoacyl-[acyl-carrier-protein]
           synthase III protein 1; AltName: Full=Beta-ketoacyl-ACP
           synthase III 1; Short=KAS III 1
 gi|28807049|dbj|BAC60319.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308093536|gb|EFO43231.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein 1 [Vibrio
           parahaemolyticus AN-5034]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ +DG + D L +            + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 IISTHIYADGQFGDLLSLPVPERGKDVDKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|15893125|ref|NP_360839.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia conorii
           str. Malish 7]
 gi|157829033|ref|YP_001495275.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165933757|ref|YP_001650546.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           rickettsii str. Iowa]
 gi|229587135|ref|YP_002845636.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia africae
           ESF-5]
 gi|34098666|sp|Q92GC1|FABH_RICCN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166233394|sp|A8GTP2|FABH_RICRS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|189037899|sp|B0BV80|FABH_RICRO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|15620332|gb|AAL03740.1| 3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia conorii
           str. Malish 7]
 gi|157801514|gb|ABV76767.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia
           rickettsii str. 'Sheila Smith']
 gi|165908844|gb|ABY73140.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rickettsia
           rickettsii str. Iowa]
 gi|228022185|gb|ACP53893.1| 3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia africae
           ESF-5]
          Length = 318

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 211/318 (66%), Gaps = 7/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDTEYTSHLALKSAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SV+DIDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISVNDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            S   + +++IG++  + ++DW+DR+TCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 SSDKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGS-YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            S G+ Y + LY +GG S +   G I M+G+ +F++A+EK  + I+ +  +   ++ +ID
Sbjct: 181 FSSGADYDEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQQSIKDLLHANQFSVSDID 240

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           +F+PHQAN RIIN + + + I   KV+ TVD H N SAASIPLAL+     G++KKGD L
Sbjct: 241 YFIPHQANIRIINKLAELLNIEEHKVVKTVDKHANCSAASIPLALSTLKASGKIKKGDIL 300

Query: 307 LLEAMGGGFTSGTVLLRW 324
           L  A+G G T G+  +RW
Sbjct: 301 LFSAIGAGLTWGSAFIRW 318


>gi|78065705|ref|YP_368474.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia sp.
           383]
 gi|123568975|sp|Q39I86|FABH_BURS3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|77966450|gb|ABB07830.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia sp.
           383]
          Length = 329

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 212/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLTDRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAAGIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   E    
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + G+L + L +DGSY   L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGVLGSALHADGSYSHILCTPGNVNRGVIEGSAFLYMDGQAVFKLAVNVLEKVAIE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                +L  E IDW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLA   
Sbjct: 239 ALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLAFDT 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIQRGQHVLIEGVGGGFTWGASVFRY 329


>gi|262393767|ref|YP_003285621.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio sp. Ex25]
 gi|262337361|gb|ACY51156.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio sp. Ex25]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 216/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA ++ET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAENETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKNVLVIGSDALSKTCDPTDRSTIILFGDGAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ SDG + + L +            + M G  VFK AV +  +L++   ++ ++ 
Sbjct: 174 IISTHIYSDGQFGELLSLPVPERGQDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPSALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|160871931|ref|ZP_02062063.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3
           (3-oxoacyl-[acyl-carrier-protein] synthase III)
           (Beta-ketoacyl-ACP synthase III)(KAS III) (EcFabH)
           [Rickettsiella grylli]
 gi|159120730|gb|EDP46068.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3
           (3-oxoacyl-[acyl-carrier-protein] synthase III)
           (Beta-ketoacyl-ACP synthase III)(KAS III) (EcFabH)
           [Rickettsiella grylli]
          Length = 316

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 217/324 (66%), Gaps = 8/324 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP ++L+N++LE  V T++ WI  R GI  R I G D++TAS+  AAA
Sbjct: 1   MKYSRIAGTGSYLPEKILTNAELEKKVATTNEWIVARTGIRERRIIGPDDSTASMAVAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A +S  +I LIIVATSTPD+ FPSTA  +Q  LG     AFD+ A C+GF YA+
Sbjct: 61  QHALLAASISPKNIQLIIVATSTPDKFFPSTACLVQAGLGYDGCPAFDIVAACAGFNYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD +IRSG V   +VIGS++ S I++W DRSTCVLFGDGAGA++L+  +       + 
Sbjct: 121 SVADKFIRSGTVETALVIGSESMSTIINWEDRSTCVLFGDGAGAVVLQAAK-------EP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GI+S +L + GSY D L +D G      +  ++M+G  VFK AV K   ++E+   S  +
Sbjct: 174 GIISAHLHAAGSYKDLLSLDTGLKKG-DLPQLKMQGSEVFKIAVNKLSSVLEETLASNKI 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
             E+IDWF+PHQAN RII ++ +K+K+  D+V++T+D  GNTSAASIPLAL  AV++GR+
Sbjct: 233 DKEDIDWFIPHQANLRIIKAMANKLKMTLDQVVITLDQQGNTSAASIPLALDRAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LL+E+ G G   G+ L+R+
Sbjct: 293 QRGQLLLMESFGAGLAWGSALVRY 316


>gi|161831071|ref|YP_001596423.1| 3-oxoacyl-(acyl carrier protein) synthase III [Coxiella burnetii
           RSA 331]
 gi|189037890|sp|A9NBY3|FABH_COXBR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|161762938|gb|ABX78580.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Coxiella burnetii
           RSA 331]
          Length = 319

 Score =  288 bits (738), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 143/325 (44%), Positives = 214/325 (65%), Gaps = 9/325 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRH-IAGKDETTASLGEAA 59
           M  + ++G+G  +P+++LSN+DLE +V+T+D WI +RVG+  RH IA   + T ++   A
Sbjct: 1   MTYARIQGVGSYIPQQILSNADLEKMVNTTDEWIMQRVGVRERHVIANSPDNTTTMAVDA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVY 118
           A+ A+  A +    ID+IIV T+T +  FPSTA  +Q  L ++    AFD+ A C+GFVY
Sbjct: 61  AKRAIEMAGIDPAVIDMIIVGTATAEYYFPSTACLVQKHLNLREDIPAFDINAACAGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ AD YIR+   + ++VIG D+ +++VDW DRSTC+LFGDGAGA+IL+       +  
Sbjct: 121 ALSIADQYIRNEGAKHILVIGVDSLTKVVDWKDRSTCILFGDGAGAVILQ-------AHK 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           + GIL+T L ++G Y D +    G     +V  + M GK VFK AV K  E+++++ + +
Sbjct: 174 EPGILNTILHANGDYSDLITAKSGVWERESVPHLHMYGKEVFKLAVTKLGEIVDEIIEKS 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            L    IDW +PHQAN RII +   ++ +P ++VI+T++ HGNTSAASIPLAL  AV+ G
Sbjct: 234 GLKQSGIDWLIPHQANLRIIEATAKRLGLPRERVILTIEQHGNTSAASIPLALDAAVRAG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K+GD LLLEA G G   G  LL+
Sbjct: 294 KIKRGDTLLLEAFGAGLAWGAALLK 318


>gi|156502571|ref|YP_001428636.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|290953017|ref|ZP_06557638.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313783|ref|ZP_06804357.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. holarctica URFT1]
 gi|156253174|gb|ABU61680.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Francisella
           tularensis subsp. holarctica FTNF002-00]
          Length = 323

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 205/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+  +  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTILQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKPGDTIISEAFGAGFVWG 317


>gi|325523017|gb|EGD01437.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia sp.
           TJI49]
          Length = 329

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 215/332 (64%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLTDRLAQEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAAGIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPDV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLHMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E IDW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQIDWLIPHQANIRIMTSTCRKLGLPQERMVVTVGEHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRY 329


>gi|225849366|ref|YP_002729530.1| 3-oxoacyl-(acyl carrier protein) synthase III [Sulfurihydrogenibium
           azorense Az-Fu1]
 gi|225644392|gb|ACN99442.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1
           (3-oxoacyl-[acyl-carrier-protein] synthase III protein
           1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1)
           (bFabH1) [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 310

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 148/321 (46%), Positives = 211/321 (65%), Gaps = 13/321 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S + G+G+ +P RVL+N DLE I+DTSD WI  R GI  RHIA +    + L   ++++A
Sbjct: 3   SKITGLGMYIPERVLTNFDLEKILDTSDEWITTRTGIKERHIADEWVKASDLALHSSKEA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           +  A +S  DID+I+VATSTPD  FPSTA  + ++LG K   AFD  A CSGF+Y +T A
Sbjct: 63  IEMAGISPKDIDVILVATSTPDMIFPSTACFLSDKLGCKNPMAFDFSAACSGFIYGLTIA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           DS+I+SG    V+V+GS+ FS+I+DWSDR+T VLFGDGAG+++L     K    +D  IL
Sbjct: 123 DSFIKSGKANHVLVVGSEVFSKIIDWSDRTTAVLFGDGAGSVVLS----KSDDSSD--IL 176

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST + S+GS+   L+   G         +RM+G+  FK+A++   +   K      LT  
Sbjct: 177 STVMKSEGSHWQLLHCQVGEK-------LRMQGRETFKHAIKSMEQACNKALAKAGLTKN 229

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           +I   +PHQAN RII+++ +K++IP +KV V +  +GNTSAASIP+A+  A KEGR+ +G
Sbjct: 230 DIKLVIPHQANVRIIDALAEKLEIPKEKVYVNIHKYGNTSAASIPIAMYEAYKEGRINRG 289

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +LL A GGG T G V++R+
Sbjct: 290 DYILLTAFGGGLTWGAVVIRF 310


>gi|157826224|ref|YP_001493944.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia akari
           str. Hartford]
 gi|166233391|sp|A8GPW1|FABH_RICAH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157800182|gb|ABV75436.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rickettsia akari
           str. Hartford]
          Length = 317

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 208/317 (65%), Gaps = 6/317 (1%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   V+T+D WI+ R GIS+RHIA  +E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVETNDEWIRTRSGISQRHIADDNEYTSHLALKSAEQAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +S +D+DLII  T+T D +FPS A  +   LG+    +FD+QAVC+GFVY +  ADS I
Sbjct: 67  RVSANDVDLIITCTTTSDNSFPSVATKLHGYLGLTNIPSFDLQAVCAGFVYGLQVADSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG  + +++IG++  + ++DW+DRSTCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 ASGKYKTILLIGAEKMTSLLDWNDRSTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDW 247
            S G+  + LY  GG S + T G I M+G+ +F++A+EK  + IE +  +   ++  ID+
Sbjct: 181 FSSGADYEILYTSGGISMNGTSGKIIMQGQKLFRHAIEKMQQSIEDLLHTNQFSVSGIDY 240

Query: 248 FVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLL 307
           F+PHQAN RIIN + + + I   KV+ TV+ H N SAASIPLAL+     G++KKGD LL
Sbjct: 241 FIPHQANIRIINKLAELLNIEEHKVVKTVEKHANCSAASIPLALSTLKASGKIKKGDILL 300

Query: 308 LEAMGGGFTSGTVLLRW 324
             A+G G T G+ L+RW
Sbjct: 301 FSAIGAGLTWGSALIRW 317


>gi|332289045|ref|YP_004419897.1| hypothetical protein UMN179_00972 [Gallibacterium anatis UMN179]
 gi|330431941|gb|AEC17000.1| conserved hypothetical protein [Gallibacterium anatis UMN179]
          Length = 316

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 143/321 (44%), Positives = 208/321 (64%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP+++ +N+DLE +VDTSD WI  R GI  R IA +DET A++G  AA+ A
Sbjct: 3   SKILATGSYLPQKIRTNADLEKMVDTSDEWITTRSGIKERRIAAEDETVATMGVNAAKQA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +   +IDLI+V T+T   ++PS A  IQ  LG+K   AFD+ A C+GF+YA++ A
Sbjct: 63  LQTANIDPQEIDLIVVGTTTNSHSYPSAACQIQGILGIKDTIAFDVAAACTGFIYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D ++R+  V++ +VIG+D  SR +D +DRST VLFGDGAGA+ILE  E +       GI+
Sbjct: 123 DQFVRNNQVKKALVIGADLNSRHLDETDRSTVVLFGDGAGAVILEASESE-------GII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +       L +          G I M+G A FK AV +   ++E+   S HL  +
Sbjct: 176 STHLHASSDMEGMLALSQTQRNDEKSGYITMQGNATFKLAVSQLSNVVEETLSSNHLDKK 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           +IDW VPHQAN RII++   K+ +   +V++T+D + NTSAA++P AL  A+++GR+K+G
Sbjct: 236 DIDWLVPHQANLRIISATAKKLDMDMSQVVITLDRYANTSAATVPTALDEAIRDGRIKRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSALVRY 316


>gi|259908798|ref|YP_002649154.1| 3-oxoacyl-(acyl carrier protein) synthase III [Erwinia pyrifoliae
           Ep1/96]
 gi|224964420|emb|CAX55929.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Erwinia pyrifoliae
           Ep1/96]
 gi|283478778|emb|CAY74694.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Erwinia pyrifoliae
           DSM 12163]
          Length = 317

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 148/318 (46%), Positives = 207/318 (65%), Gaps = 8/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  AL  +
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIHERRIAGPDETVATMGFQAAMRALEMS 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +DI LI+VAT++    FPS+A  IQ  LG+    +FD+ A C+GF YA++ AD YI
Sbjct: 67  GIDKNDIGLIVVATTSSSHAFPSSACMIQQMLGIDDAASFDLAAACAGFTYALSVADQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++GVV+  +VIG+D  +R++D +DRST +LFGDGAGA++L   E       + GI+ST+L
Sbjct: 127 KNGVVKNALVIGADVLARMLDPNDRSTLILFGDGAGAVVLGASE-------EQGIISTHL 179

Query: 188 CSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            +DG Y   L + +           + M G  VFK AV +   ++E+   + +L    ID
Sbjct: 180 HADGRYGQLLTLTNQDRQRQENPSYVTMAGNEVFKVAVTELAHIVEETLQANNLDRTAID 239

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           W VPHQAN RIIN+   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+++G  +
Sbjct: 240 WLVPHQANLRIINATARKLGMDMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIQRGQLV 299

Query: 307 LLEAMGGGFTSGTVLLRW 324
           LLEA GGGFT G+ L+R+
Sbjct: 300 LLEAFGGGFTWGSALVRF 317


>gi|156975183|ref|YP_001446090.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio harveyi ATCC
           BAA-1116]
 gi|156526777|gb|ABU71863.1| hypothetical protein VIBHAR_02910 [Vibrio harveyi ATCC BAA-1116]
          Length = 316

 Score =  288 bits (737), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 212/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSASQVQGKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGD AGA+++   E       + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDAAGAVVIGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ SDG + D L +            + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 IISTHVYSDGQFGDLLSLPVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|34581204|ref|ZP_00142684.1| 3-oxoacyl-3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia
           sibirica 246]
 gi|28262589|gb|EAA26093.1| 3-oxoacyl-3-oxoacyl-[acyl carrier protein] synthase III [Rickettsia
           sibirica 246]
          Length = 318

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 141/318 (44%), Positives = 210/318 (66%), Gaps = 7/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +++SN +L   VDT+D WI+ R GI++RHIAG  E T+ L   +A  A+  A
Sbjct: 7   GCGGYLPSKIVSNDELAKFVDTNDEWIRTRTGITQRHIAGDTEYTSHLALKSAEKAIADA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +SV+DIDLII  T+TPD +FPS A  +Q  LG+    +FD+QAVC+GFVY +  A+S I
Sbjct: 67  GISVNDIDLIITCTTTPDNSFPSVASKLQGYLGLTNIPSFDLQAVCAGFVYGLQVANSLI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            S   + +++IG++  + ++DW+DR+TCVLFGDGAG++IL+       S  D+G++ + +
Sbjct: 127 SSDKYKTILLIGAEKMTSLLDWNDRTTCVLFGDGAGSVILQ------RSSDDSGLIDSNI 180

Query: 188 CSDGS-YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            S G+ Y + LY +GG S +   G I M+G+ +F++A+EK  + I  +  +   ++ +ID
Sbjct: 181 FSSGADYDEILYTNGGVSMNGISGKIVMQGQKLFRHAIEKMQQSINDLLHANQFSVSDID 240

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           +F+PHQAN RIIN + + + I   KV+ TVD H N SAASIPLAL+     G++KKGD L
Sbjct: 241 YFIPHQANIRIINKLAELLNIEEHKVVKTVDKHANCSAASIPLALSTLKASGKIKKGDIL 300

Query: 307 LLEAMGGGFTSGTVLLRW 324
           L  A+G G T G+  +RW
Sbjct: 301 LFSAIGAGLTWGSAFIRW 318


>gi|330815973|ref|YP_004359678.1| 3-ketoacyl-ACP synthase III [Burkholderia gladioli BSR3]
 gi|327368366|gb|AEA59722.1| 3-ketoacyl-ACP synthase III [Burkholderia gladioli BSR3]
          Length = 329

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 164/335 (48%), Positives = 218/335 (65%), Gaps = 23/335 (6%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPNRVTNQALAERLAKDGIETSDEWIVARTGIHARHFADPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG++ G  AFD+QAVCSG
Sbjct: 66  LIAAQRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIRNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYAIATADSFIRSGQHRNALVIGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAV---EK-AVE 229
              + GIL + L +DGSY   L   G  +     G   + M+G+AVFK AV   EK AVE
Sbjct: 182 ---EPGILGSALHADGSYSHILCTPGNVNGGVIAGSAFLHMDGQAVFKLAVNVLEKVAVE 238

Query: 230 LIEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPL 289
            +EK      L  + +DW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPL
Sbjct: 239 ALEK----AGLAADQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVGEHGNTSAASIPL 294

Query: 290 ALAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AL VAV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 295 ALDVAVRDGRIQRGQTVLIEGVGGGFTWGASVFRF 329


>gi|167627577|ref|YP_001678077.1| beta-ketoacyl-acyl-carrier-protein synthase I [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167597578|gb|ABZ87576.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 323

 Score =  288 bits (737), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 203/322 (63%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCANETETTSFMATEAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF--AFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +       FD+ A CSGFVYA+ 
Sbjct: 63  LDSAKINTNDIDMIIVATSTPDFIMPSTASMVHQNLQIDHFNVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +G+ + ++VIG++  +R++DWSDRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGISKNILVIGAEKMTRVLDWSDRSTCVLFGDGAGAVVI-------STSDEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L + +  
Sbjct: 176 ILSSLLYTDGSCLDMLNVPNNLPTSRGEAINIDPYLIMEGNKVFKFAVSRLSSLADDLIK 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +    IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  A+K
Sbjct: 236 EAGIQANQIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAIK 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKSGDTIISEAFGAGFVWG 317


>gi|188996759|ref|YP_001931010.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfurihydrogenibium
           sp. YO3AOP1]
 gi|188931826|gb|ACD66456.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sulfurihydrogenibium
           sp. YO3AOP1]
          Length = 310

 Score =  288 bits (737), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 209/323 (64%), Gaps = 13/323 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S ++GIG+ +P RVL+N DLE I+DTSD WI  R GI  R IA +    + L   A++
Sbjct: 1   MSSEIKGIGMYVPERVLTNHDLEKILDTSDEWITTRTGIKERRIADEWVKASDLAFHASK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+ +A ++  DID++IVATSTPD  FPSTA  + ++LG K   AFD  A CSGF+Y +T
Sbjct: 61  EAIENAGLTPKDIDIVIVATSTPDNVFPSTACILADKLGCKNPMAFDFSAACSGFIYGIT 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            ADS+I+SG    ++V+GS+ FS+I+DW+DR+T VLFGDGAGA+++     K +S +D  
Sbjct: 121 IADSFIKSGKAENILVVGSEVFSKIIDWTDRTTAVLFGDGAGAVVIS----KSNSSSD-- 174

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST + SDGSY   L+   G         +RM+G+  FK AV+       K      + 
Sbjct: 175 ILSTVMKSDGSYGHLLHCQVGEK-------LRMQGRETFKQAVKSMETACLKALQKAGIN 227

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            E+I   +PHQAN RII ++ +K+++P +KV   +  +GNTSAASIP+A+  A KEGR  
Sbjct: 228 KEDIKLVIPHQANIRIIQALAEKLELPLEKVYSNIHEYGNTSAASIPIAIYEAYKEGRFN 287

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD +LL A GGG T G  ++R+
Sbjct: 288 KGDYILLTAFGGGLTWGAAVIRF 310


>gi|323491972|ref|ZP_08097141.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio brasiliensis
           LMG 20546]
 gi|323313830|gb|EGA66925.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio brasiliensis
           LMG 20546]
          Length = 316

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 146/323 (45%), Positives = 214/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V SN+DLE +VDTSD WI  R GI  R IA ++ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQVRSNADLEKMVDTSDEWIVTRTGIKERRIAAENETVADMGYIAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +L +K   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLEIKGCPAFDLGAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVVGQSE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ SDG + + L ++           + M G  VFK AV +  +L++    +  + 
Sbjct: 174 ILSTHIYSDGRFGELLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLAANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|258621212|ref|ZP_05716246.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio mimicus VM573]
 gi|262170988|ref|ZP_06038666.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio mimicus
           MB-451]
 gi|258586600|gb|EEW11315.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio mimicus VM573]
 gi|261892064|gb|EEY38050.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio mimicus
           MB-451]
          Length = 316

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA  +ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIRERRIAADNETVADMAFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DID+IIVAT++P  TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAIDMAGIDKNDIDMIIVATTSPSHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SGV + ++VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGVCKNILVIGSDALSKSCDPTDRSTIILFGDGAGAVVI------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG Y D L ++       +   + M G  VFK AV +  +L+     +  + 
Sbjct: 174 ILSTHIHADGEYGDLLSLEVPVRGGDSDKWLHMAGNEVFKVAVTQLSKLVVDTLKANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQMLLLEAFGGGFTWGSALVKF 316


>gi|302036166|ref|YP_003796488.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Candidatus
           Nitrospira defluvii]
 gi|300604230|emb|CBK40562.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Candidatus
           Nitrospira defluvii]
          Length = 325

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 149/332 (44%), Positives = 214/332 (64%), Gaps = 15/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIR+ + G G   P RV++N+DLE +V TSD WI+ R GI  R IA + +  + LG  AA
Sbjct: 1   MIRARITGTGSYAPDRVMTNADLEKLVATSDEWIRERTGIRERRIAAEGQACSDLGLIAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +S  ++D+I++AT T D   PSTA  +Q+RLG  R  A D+ A C GFVYA+
Sbjct: 61  ERALKAAGISAGELDMILLATCTGDMPLPSTACLLQHRLGATRAAACDVSAACCGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             AD+YIR+G +R V+V+GS+  S I DW+DR+TC+LFGDGAGA ++       +S  + 
Sbjct: 121 GVADAYIRTG-MRHVLVVGSEVMSTITDWTDRNTCILFGDGAGAAVVS------ASDGER 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG-----PS---TSRTVGCIRMEGKAVFKYAVEKAVELIE 232
           G+LST+L SDGS  D + V GG     PS    S     I+M+G   FK AV    E+  
Sbjct: 174 GVLSTHLHSDGSLSDLIVVPGGGTRIPPSEAMVSERSQYIKMKGNETFKVAVRTLEEVAR 233

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +   + HL+++ +D ++PHQAN RII ++ D++ +P +KV++ +D +GNTSAASIP+AL 
Sbjct: 234 ETLAAHHLSVDELDVYIPHQANLRIIKAVADRLHLPLEKVVLNMDRYGNTSAASIPIALD 293

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GRVK+G  ++  A G G T  + L+RW
Sbjct: 294 EAVRDGRVKEGQLVMFGAFGAGLTWASALVRW 325


>gi|224826376|ref|ZP_03699478.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Lutiella nitroferrum
           2002]
 gi|224601477|gb|EEG07658.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Lutiella nitroferrum
           2002]
          Length = 319

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 215/326 (65%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP  VL+N+ L   +DTSD WI  R GI  RHIA + ETT+ L   AA
Sbjct: 1   MAYSRILGTGSYLPPTVLTNAMLAERIDTSDEWIVSRTGIRARHIADEQETTSDLALKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + AL  A ++ D+IDLI+VAT+TPD  FPSTA  +Q +LG+    AFD+QAVC+GF+YA+
Sbjct: 61  QAALADAGVAADEIDLIVVATTTPDMVFPSTACLLQEKLGVHGCAAFDVQAVCAGFMYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            TA++YI+SG+ ++ +V+G++  SRI+DW DR TCVLFGDGAGA++L      G S  + 
Sbjct: 121 ITANNYIKSGMAKKALVVGAEVMSRILDWQDRRTCVLFGDGAGAVVL------GES-DEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL   L +DG Y D L      +  +  G   + M+G AVFK+AV+   ++ EK     
Sbjct: 174 GILHAKLAADGRYKDILNTPAQIADGKIQGMPYLHMDGPAVFKFAVKALSDIAEKTLGEV 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            ++ + +DW VPHQAN RII S    + +P ++V+VT+   GNTSAASIPLAL  AV++G
Sbjct: 234 GMSKDQVDWLVPHQANLRIIESTAKHLGLPMERVVVTLPEQGNTSAASIPLALDAAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+G  ++LE +GGGF  G VLL +
Sbjct: 294 RIKRGQTVMLEGIGGGFAWGAVLLTF 319


>gi|269962042|ref|ZP_06176396.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio harveyi 1DA3]
 gi|269833126|gb|EEZ87231.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio harveyi 1DA3]
          Length = 316

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 210/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSG VYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQGKLGIKGCPAFDLAAACSGLVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGD AGA++L   E       + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDAAGAVVLGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ SDG + D L +            + M G  VFK AV +   L++   ++  + 
Sbjct: 174 IISTHIYSDGQFGDLLSLPVPERGKDANKWLHMAGNEVFKVAVTQLSRLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|167837362|ref|ZP_02464245.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           thailandensis MSMB43]
          Length = 329

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 213/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N +L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQELADRLAKDGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AA+ A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LIAAQRAIEAADVDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+  ADS+IR+G  R  +++G++TFSRI+D+ DR+TCVLFGDGAGA++L   E    
Sbjct: 126 FAYALAMADSFIRTGQHRTALIVGAETFSRILDFKDRTTCVLFGDGAGAVVLSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEK 233
              + GIL + L +DGSY + L   G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGILGSALHADGSYSNILCTPGNVNRGVIAGSAFLHMDGQAVFKLAVNLLEKVAVE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                 L  E +DW +PHQAN RI+ S   K+ +P +++IVTVD HGNTSAASIPLA  V
Sbjct: 239 ALSKADLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMIVTVDEHGNTSAASIPLAFDV 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+   +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRDQHVLIEGVGGGFTWGASVFRY 329


>gi|241668144|ref|ZP_04755722.1| Beta-ketoacyl-acyl-carrier-protein synthase I [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254876679|ref|ZP_05249389.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
 gi|254842700|gb|EET21114.1| 3-oxoacyl-[acyl-carrier-protein] synthase [Francisella philomiragia
           subsp. philomiragia ATCC 25015]
          Length = 323

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 202/322 (62%), Gaps = 14/322 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCANETETTSFMATEAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF--AFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +       FD+ A CSGFVYA+ 
Sbjct: 63  LDSAKINANDIDMIIVATSTPDFIMPSTASMVHQNLQIDHFNVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +G+ + ++VIG++  +R++DWSDRSTCVLFGDGAGA+++   + K        
Sbjct: 123 IAKQYIETGISKNILVIGAEKMTRVLDWSDRSTCVLFGDGAGAVVISISDEKK------- 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L + +  
Sbjct: 176 ILSSLLYTDGSCLDMLNVPNNLPTSRGEAINIDPYLIMEGNKVFKFAVSRLSSLADNLIK 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +    IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  A+K
Sbjct: 236 EAGIQANQIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAIK 295

Query: 297 EGRVKKGDCLLLEAMGGGFTSG 318
             ++K GD ++ EA G GF  G
Sbjct: 296 TNQIKSGDTIISEAFGAGFVWG 317


>gi|22125650|ref|NP_669073.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis KIM
           10]
 gi|45442047|ref|NP_993586.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51596795|ref|YP_070986.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108807923|ref|YP_651839.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           Antiqua]
 gi|108812194|ref|YP_647961.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           Nepal516]
 gi|149366513|ref|ZP_01888547.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           CA88-4125]
 gi|153949287|ref|YP_001400553.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162420368|ref|YP_001607831.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           Angola]
 gi|165925513|ref|ZP_02221345.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165938426|ref|ZP_02226983.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008645|ref|ZP_02229543.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|167401742|ref|ZP_02307233.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421876|ref|ZP_02313629.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|170023925|ref|YP_001720430.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           pseudotuberculosis YPIII]
 gi|186895866|ref|YP_001872978.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           pseudotuberculosis PB1/+]
 gi|218928733|ref|YP_002346608.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           CO92]
 gi|229843697|ref|ZP_04463840.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229894441|ref|ZP_04509623.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Pestoides A]
 gi|229902519|ref|ZP_04517638.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Nepal516]
 gi|270490304|ref|ZP_06207378.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis KIM
           D27]
 gi|294504201|ref|YP_003568263.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis Z176003]
 gi|34098648|sp|Q8ZFT7|FABH_YERPE RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|81639132|sp|Q669L1|FABH_YERPS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|122979558|sp|Q1C6M8|FABH_YERPA RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|123373168|sp|Q1CI19|FABH_YERPN RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971605|sp|A7FH25|FABH_YERP3 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|21958561|gb|AAM85324.1|AE013778_10 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis KIM
           10]
 gi|45436910|gb|AAS62463.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51590077|emb|CAH21711.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia
           pseudotuberculosis IP 32953]
 gi|108775842|gb|ABG18361.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Nepal516]
 gi|108779836|gb|ABG13894.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Antiqua]
 gi|115347344|emb|CAL20242.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           CO92]
 gi|149290887|gb|EDM40962.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           CA88-4125]
 gi|152960782|gb|ABS48243.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia
           pseudotuberculosis IP 31758]
 gi|162353183|gb|ABX87131.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Angola]
 gi|165913541|gb|EDR32161.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165922622|gb|EDR39773.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165993027|gb|EDR45328.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166960361|gb|EDR56382.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167048847|gb|EDR60255.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|169750459|gb|ACA67977.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Yersinia
           pseudotuberculosis YPIII]
 gi|186698892|gb|ACC89521.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Yersinia
           pseudotuberculosis PB1/+]
 gi|229680565|gb|EEO76662.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Nepal516]
 gi|229689305|gb|EEO81368.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Orientalis str. India 195]
 gi|229703460|gb|EEO90477.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Pestoides A]
 gi|262362318|gb|ACY59039.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis D106004]
 gi|262366252|gb|ACY62809.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis D182038]
 gi|270338808|gb|EFA49585.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis KIM
           D27]
 gi|294354660|gb|ADE65001.1| 3-oxoacyl-(acyl carrier protein) synthase [Yersinia pestis Z176003]
 gi|320014737|gb|ADV98308.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           biovar Medievalis str. Harbin 35]
          Length = 316

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 204/321 (63%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  A
Sbjct: 3   TKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVATMGFQAAEKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  DDI LIIVAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ A
Sbjct: 63  LEMAGIDKDDIGLIIVATTSSSHAFPSSACQVQRMLGIKDAASFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D Y++SG V+  +VIGSD  SR +D  DR T +LFGDGAGA++L   E         GI+
Sbjct: 123 DQYVKSGAVKHAIVIGSDVLSRALDPEDRGTIILFGDGAGAVVLGASE-------QPGIM 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +DG Y + L +            + M G  VFK AV +   ++++   + +L   
Sbjct: 176 STHLHADGRYGELLALPYPDRQQDQPAYVTMAGNEVFKVAVTELAHIVDETLQANNLDRT 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV++T+D HGNTSAAS+P A   AV++GR+++G
Sbjct: 236 ALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPSAFDEAVRDGRIQRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 296 QLVLLEAFGGGFTWGSALVRF 316


>gi|225850316|ref|YP_002730550.1| 3-oxoacyl-(acyl carrier protein) synthase III [Persephonella marina
           EX-H1]
 gi|254783818|sp|C0QPF4|FABH_PERMH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|225645509|gb|ACO03695.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1
           (3-oxoacyl-[acyl-carrier-protein] synthase III protein
           1) (Beta-ketoacyl-ACP synthase III 1) (KAS III 1)
           (bFabH1) [Persephonella marina EX-H1]
          Length = 313

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 213/323 (65%), Gaps = 13/323 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I++ ++GIG+++P R+L+N DLE  +DTSD WI  R GI  R IA + E  + +   AA+
Sbjct: 4   IKAEIKGIGINIPERILTNFDLEKFLDTSDEWITTRTGIKERRIAEEWEKASDIALPAAK 63

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+ +A ++  DID +IVATSTPD TFPSTA  + ++LG  +  AFD+ A CSGF+Y +T
Sbjct: 64  EAIENAGLTPKDIDAVIVATSTPDMTFPSTACFLADKLGSSKPMAFDISAACSGFIYGLT 123

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+S+I+SG    ++V+G++ FS+I+DW+DRST V+FGDGAGA+++        S  ++ 
Sbjct: 124 LANSFIKSGQFENILVVGAEVFSQIIDWNDRSTAVIFGDGAGAVVV------SKSDGESD 177

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILS  + SDGS+   LY   G         +RM G+  FK A++      +K      LT
Sbjct: 178 ILSAVMKSDGSHWGSLYCPVGEK-------LRMRGRETFKLAIKSMETASKKALQKAGLT 230

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
           +E+I   +PHQAN RIIN++ ++M++P ++V   +  +GNTSAASIP+A   A KEG++ 
Sbjct: 231 LEDIKLVIPHQANIRIINALAERMELPEERVYSNIHRYGNTSAASIPIAFYEAWKEGKID 290

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           KGD +LL A GGG T G ++L++
Sbjct: 291 KGDHILLTAFGGGLTWGAIVLKF 313


>gi|167586618|ref|ZP_02379006.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ubonensis Bu]
          Length = 329

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 214/331 (64%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D  T+ L 
Sbjct: 6   LYSRVLGTGSFLPPDRVTNQQLADRLAKDGIETSDEWIVARTGIHARHFAAPDVATSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A++    IDLIIVATSTPD  FPSTA  +Q++LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQSKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGS 175
           F YA+ TADS+IRSG  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E    
Sbjct: 126 FAYAMATADSFIRSGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVILSASE---- 181

Query: 176 SMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEK 233
              + G+L + L +DGSY + L V G  +     G   + M+G+AVFK AV    ++  +
Sbjct: 182 ---EPGVLGSALHADGSYAEILCVPGHVNGGVVAGNAFLHMDGQAVFKLAVNVLEKVAIE 238

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
                +L  E +DW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLAL  
Sbjct: 239 ALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVGEHGNTSAASIPLALDA 298

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 299 AVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|327399367|ref|YP_004340236.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Hippea maritima DSM
           10411]
 gi|327181996|gb|AEA34177.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Hippea maritima DSM
           10411]
          Length = 326

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 206/326 (63%), Gaps = 19/326 (5%)

Query: 10  GLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEM 69
           G  LP+++L+N DLE +VDTSD WI +R GI  RHI    E+T+ L   AA DAL  +++
Sbjct: 9   GAYLPKKILTNFDLEKMVDTSDEWITQRTGIKIRHIVEDGESTSDLAYKAALDALKGSDL 68

Query: 70  SVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRS 129
           S  DI+LI+VAT TPDQ  P+TA+ +Q +LG    F FD+ A CSGF+YA++ A++YI++
Sbjct: 69  SPSDIELIVVATVTPDQPLPATALFVQEKLGAYNAFGFDINAACSGFMYALSVANAYIKA 128

Query: 130 GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCS 189
           G+V+  +VIGS+  S+IVDW+DR+TCVLFGDGA  ++LE VE +     + GI+S  + S
Sbjct: 129 GMVKNALVIGSEVLSKIVDWTDRTTCVLFGDGAACVLLEAVEDE-----NKGIISMVMHS 183

Query: 190 DGSYIDKLYVDGGPSTSRTVGC-----------IRMEGKAVFKYAVEKAVELIEKVFDST 238
           DG Y D + V   P+      C           I+M+G   FK AV     + ++  D  
Sbjct: 184 DGRYTDLMRV---PAPGSAKPCSEEVIEGREIYIKMKGNETFKMAVRSIASVSKEALDLV 240

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           ++   ++D  V HQAN RII S+  +  I  D+VIVT+D H NTSAASIPLAL  A K G
Sbjct: 241 NMDFNDVDLMVSHQANKRIIESVAKRAGIDEDRVIVTIDKHANTSAASIPLALDWAYKSG 300

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+GD +LL + G   T    ++RW
Sbjct: 301 RIKEGDVILLNSFGASLTWAAGVVRW 326


>gi|326424116|ref|NP_761811.2| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio vulnificus
           CMCP6]
 gi|319999497|gb|AAO11338.2| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Vibrio
           vulnificus CMCP6]
          Length = 316

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 144/323 (44%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP ++ +N+DLE +V+TSD WI  R GI  R IA ++ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQIRTNADLEKMVETSDEWIVARTGIKERRIAAENETVADMGFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AF   A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFARAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I++G+ + V+VIGSDT S+  D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 IADQHIKTGMCKNVLVIGSDTLSKTCDPTDRSTIILFGDGAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + D L ++           + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 ILSTHIYADGEFGDLLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANGMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+R+
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVRF 316


>gi|59712349|ref|YP_205125.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio fischeri
           ES114]
 gi|197334602|ref|YP_002156564.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 protein 1 [Vibrio
           fischeri MJ11]
 gi|75431586|sp|Q5E409|FABH_VIBF1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|59480450|gb|AAW86237.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio fischeri ES114]
 gi|197316092|gb|ACH65539.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 protein 1 [Vibrio
           fischeri MJ11]
          Length = 317

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/327 (45%), Positives = 212/327 (64%), Gaps = 14/327 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP ++ SN+DLE +VDTSD WI  R GIS R IAG+DE+ A++   A+ 
Sbjct: 1   MYSKILGTGSYLPAQIRSNADLEKMVDTSDEWILARTGISERRIAGEDESVATMAHLASV 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLII+ATSTP  +FPS A  +Q  LG++   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIILATSTPTYSFPSAACEVQGLLGIQGCPAFDLSAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I++G+ + V+VIGSD  S   D  DRST +LFGDGAGA++L   E       + G
Sbjct: 121 VADQHIKTGMAKNVLVIGSDAVSHTCDPEDRSTIILFGDGAGAVVLGQSE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           I+ST+L +DG + + L +   P  SR        + M G  VFK AV +   L+++    
Sbjct: 174 IISTHLHADGKFGELLSL---PVPSRKNEEADKWLYMAGNEVFKVAVTQLSNLVKETLQE 230

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +    +DW VPHQAN RII +   K+ +  D+V+VT+D HGNTSAA++P AL  AV++
Sbjct: 231 NQMDKSELDWLVPHQANLRIIKATAKKLSMSMDQVVVTLDRHGNTSAATVPTALDEAVRD 290

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+++G  LLLEA GGGFT G+ L+++
Sbjct: 291 GRIQRGQTLLLEAFGGGFTWGSALVKF 317


>gi|332162108|ref|YP_004298685.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325666338|gb|ADZ42982.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330861068|emb|CBX71337.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia
           enterocolitica W22703]
          Length = 317

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 207/325 (63%), Gaps = 14/325 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET AS+G  AA  A
Sbjct: 3   TKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVASMGFHAAEKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  +DI LIIVAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ A
Sbjct: 63  LEMAGIDKNDIGLIIVATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D Y++SG V+  +VIGSD  SR ++  DR T +LFGDGAGA++L   E         GIL
Sbjct: 123 DQYVKSGAVKHAIVIGSDVLSRALNPEDRGTIILFGDGAGAVVLGASE-------QPGIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ST+L +DG Y + L +   P   R        + M G  VFK AV +   ++++   + +
Sbjct: 176 STHLHADGKYGELLAL---PYQDRQHQEQPAYVTMAGNEVFKVAVTELAHIVDETLQANN 232

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L    +DW VPHQAN RII++   K+ +  DKV++T+D HGNTSAAS+P AL  AV++GR
Sbjct: 233 LDRSALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAALDEAVRDGR 292

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G  +LLEA GGGFT G+ L+R+
Sbjct: 293 IQRGQLVLLEAFGGGFTWGSALVRF 317


>gi|73541952|ref|YP_296472.1| 3-oxoacyl-(acyl carrier protein) synthase III [Ralstonia eutropha
           JMP134]
 gi|123624559|sp|Q46Z05|FABH_RALEJ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|72119365|gb|AAZ61628.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia eutropha
           JMP134]
          Length = 326

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/324 (48%), Positives = 209/324 (64%), Gaps = 15/324 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP R ++N DL     E  ++TSD WI  R GIS RH A  D  ++ L   AA  
Sbjct: 9   GTGSYLPPRRVTNQDLAAQLAEKGIETSDEWIFSRSGISARHWADPDVASSDLAVKAAEQ 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK-RGFAFDMQAVCSGFVYAVT 121
           A+  A +    IDLI+VATSTPD  FPSTA  IQN+LG+  +  AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRQSIDLILVATSTPDFVFPSTACIIQNKLGINNQCAAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IRSG  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L       S+  + G
Sbjct: 129 TADKFIRSGSHRNVLVIGTEVFSRILDFNDRTTCVLFGDGAGAVVL-------SASDEPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST + SDGS++  L V G        G   + M+G+AVFK AV    ++  +   +  
Sbjct: 182 ILSTAMHSDGSHVGILCVPGNVHGGAIAGNAFLHMDGQAVFKLAVTVLDKVARETMAAAE 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +  E IDW +PHQAN RI+     K+ +P +++I  V  HGNTSAASIPLAL  AV++GR
Sbjct: 242 IQPEQIDWLIPHQANIRIMQGTARKLGLPAERMIAVVHEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLR 323
           ++ G  +L+E +GGGFT G  LLR
Sbjct: 302 IRPGQTVLMEGVGGGFTWGAALLR 325


>gi|221201338|ref|ZP_03574377.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD2M]
 gi|221208818|ref|ZP_03581816.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD2]
 gi|221214102|ref|ZP_03587075.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD1]
 gi|221166279|gb|EED98752.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD1]
 gi|221171274|gb|EEE03723.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD2]
 gi|221178606|gb|EEE11014.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Burkholderia
           multivorans CGD2M]
          Length = 329

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/332 (46%), Positives = 215/332 (64%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLHMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLA  
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVGEHGNTSAASIPLAFD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRY 329


>gi|269967351|ref|ZP_06181412.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio alginolyticus
           40B]
 gi|269828059|gb|EEZ82332.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio alginolyticus
           40B]
          Length = 316

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/323 (44%), Positives = 216/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA ++ET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAENETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKNVLVIGSDALSKTCDPTDRSTIILFGDGAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ SDG + + L +            + M G  VFK AV +  +L++   ++ ++ 
Sbjct: 174 IISTHIYSDGQFGELLSLPVPVRGQDADKWLHMAGNEVFKVAVTQLSKLVKDTLEANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  ++V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLEQVVITLDKHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|161525353|ref|YP_001580365.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           multivorans ATCC 17616]
 gi|189349910|ref|YP_001945538.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           multivorans ATCC 17616]
 gi|160342782|gb|ABX15868.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           multivorans ATCC 17616]
 gi|189333932|dbj|BAG43002.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           multivorans ATCC 17616]
          Length = 329

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 156/332 (46%), Positives = 215/332 (64%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             A+R A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG++ G  AFD+QAVCSG
Sbjct: 66  LEASRRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIRNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YAV TADS+IRSG  R  +V+G++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAVATADSFIRSGQHRTALVVGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLHMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTV  HGNTSAASIPLA  
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVGEHGNTSAASIPLAFD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRY 329


>gi|238758389|ref|ZP_04619566.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia aldovae ATCC
           35236]
 gi|238703293|gb|EEP95833.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia aldovae ATCC
           35236]
          Length = 317

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 209/327 (63%), Gaps = 14/327 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP +V SN+DLE +VDT+D WI  R GI  R IAG DET AS+   AA 
Sbjct: 1   MYTKILGTGSYLPAQVRSNADLEKMVDTTDEWIVTRTGIRERRIAGLDETVASMAFQAAN 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +AL  A +  +DI LII+AT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++
Sbjct: 61  NALEMAGIDKNDIGLIIIATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD Y++SG V+  +VIGSD  SR ++  DR T +LFGDGAGA++L   E       + G
Sbjct: 121 VADQYVKSGAVKHALVIGSDMLSRALNPEDRGTIILFGDGAGAVVLGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST+L +DG Y + L +   P   R        + M G  VFK AV +   ++++   +
Sbjct: 174 ILSTHLHADGKYGELLAL---PYQDRQHQDQPAYVTMAGNEVFKVAVTELAHIVDETLQA 230

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            +L    +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++
Sbjct: 231 NNLDRTALDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPAALDEAVRD 290

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+++G  +LLEA GGGFT G+ L+R+
Sbjct: 291 GRIQRGQLVLLEAFGGGFTWGSALVRF 317


>gi|315179575|gb|ADT86489.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio furnissii
           NCTC 11218]
          Length = 316

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 143/323 (44%), Positives = 214/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA  +ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVTRTGIRERRIAADNETVADMGFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLII+AT++   TFPS+A  +Q +LG+K   AFD+ A CSGF+Y ++
Sbjct: 61  NAIEMAGIDKNDIDLIILATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFIYGLS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + D L ++           + M G  VFK AV +  +L++    + ++ 
Sbjct: 174 ILSTHVYADGQFGDLLSLEVPERGGDVDKWLYMAGNEVFKVAVTQLSKLVKDTLAANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|332525453|ref|ZP_08401611.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rubrivivax
           benzoatilyticus JA2]
 gi|332108720|gb|EGJ09944.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rubrivivax
           benzoatilyticus JA2]
          Length = 327

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 210/326 (64%), Gaps = 14/326 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R ++N D   +     ++TSD WI  R GI  RH A     ++ L   
Sbjct: 7   SRITGTGGFLPSRRITNDDFVHMLAARGIETSDAWIVERTGIRARHFADDGVNSSDLALE 66

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           A+R AL  A  S  D+DLIIVATSTPD  FPSTA  +Q +LG+    AFD+QAVCSGFVY
Sbjct: 67  ASRRALEAAGRSAADVDLIIVATSTPDMVFPSTATILQAKLGVHGCPAFDVQAVCSGFVY 126

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+T AD+ IR+G  R  +V+G++ FSR++D++DR+TCVLFGDGAGA++LE  +V      
Sbjct: 127 ALTVADAMIRAGSARCALVVGAEVFSRLLDFNDRTTCVLFGDGAGAVVLEASDVP----- 181

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL+T L +DG +   L V G  S  +  G   +RM+G+AVFK AV         V  
Sbjct: 182 --GILATELHADGRHAGILCVPGTVSGGQVSGLPLLRMDGQAVFKLAVGVLENAARAVLA 239

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
               +  +IDW +PHQAN RI+N    K+K+  ++++VTVD HGNTSAAS+PLAL  AV+
Sbjct: 240 KAGRSEADIDWLIPHQANIRIMNGTARKLKLAPERLVVTVDEHGNTSAASVPLALDAAVR 299

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
            GRV++G+ +LLE +GGGFT G VLL
Sbjct: 300 SGRVQRGETVLLEGVGGGFTWGAVLL 325


>gi|88810817|ref|ZP_01126074.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrococcus mobilis
           Nb-231]
 gi|88792447|gb|EAR23557.1| 3-oxoacyl-(acyl carrier protein) synthase [Nitrococcus mobilis
           Nb-231]
          Length = 298

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 149/305 (48%), Positives = 202/305 (66%), Gaps = 13/305 (4%)

Query: 26  IVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPD 85
           +V+TSD WI+ R GI  RHIA   ET + L   AA+ AL  A ++  ++DL+++ATSTPD
Sbjct: 1   MVETSDAWIRERTGIIERHIAADGETCSDLAVVAAQRALEAAGIAGREVDLVVLATSTPD 60

Query: 86  QTFPSTAVNIQNRLGMK-RGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFS 144
           Q FPSTA  IQ RL +  +  AFD+ A C GF+YA+  AD +IR+G  RR +VIG++TFS
Sbjct: 61  QVFPSTACLIQERLDIPGKTIAFDIAAACCGFIYALDVADRFIRTGGARRALVIGAETFS 120

Query: 145 RIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPS 204
           RI++W DR+TCVLFGDGAGA++LE  +       + G+LST L +DG     L V  G S
Sbjct: 121 RILNWEDRTTCVLFGDGAGAVLLEAAD-------EPGVLSTQLYADGRQQALLNVPWGIS 173

Query: 205 T-----SRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQANWRIIN 259
                 + T G I M G  VFK AV     L+++   +  L  E++DW VPHQAN RI+ 
Sbjct: 174 QGYERLTPTSGKITMRGNDVFKAAVRSMGALVDETLQANDLAREDVDWLVPHQANIRIMA 233

Query: 260 SIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGGFTSGT 319
           ++  K+    ++VIVT D HGNTSAAS+PLAL VAV++GR+++G  LLLEA G GFT G+
Sbjct: 234 ALARKLGFSMEQVIVTADRHGNTSAASVPLALDVAVRDGRIQRGQLLLLEAFGAGFTWGS 293

Query: 320 VLLRW 324
            L+R+
Sbjct: 294 ALVRY 298


>gi|298505712|gb|ADI84435.1| 3-oxoacyl-(acyl carrier protein) synthase III [Geobacter
           sulfurreducens KN400]
          Length = 326

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 211/332 (63%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+R+ + G G ++P +VL+N DLE +VDTSD W+  R GI  R IA   E T++    AA
Sbjct: 1   MMRARIVGTGSAVPSKVLTNFDLEKMVDTSDEWVTTRTGIKERRIAVDGEYTSTFATLAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +   D+DL+IVAT TPD  FP+TA  +Q+ L   +  A+D+ A CSGF+YA+
Sbjct: 61  ERALEMAGVKASDLDLLIVATITPDFPFPATACVVQSNLKATKAAAYDISAACSGFIYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             A + IRSG  R+ +VIG++  SRI+DW+DR+TC+LFGDGAGA++LE  +         
Sbjct: 121 AQASNAIRSGSARKALVIGAEVLSRIIDWTDRNTCLLFGDGAGAVVLEACD------DGH 174

Query: 181 GILSTYLCSDGSYIDKLYVDG----GPSTSRTVGCIR----MEGKAVFKYAVEKAVELIE 232
           G+LST+L SDGSY + LY  G     P+  +T+   R    M+G  VFK AV    +   
Sbjct: 175 GVLSTHLHSDGSYWELLYQPGCGNRNPAVQKTLDDRRIYLMMQGNEVFKLAVRAMEDAAL 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  D+  LT  +I  F+PHQAN RII++I  ++ +P +KV V +D  GNTSAASIPLAL 
Sbjct: 235 EALDANGLTPADISLFIPHQANRRIIDAIGKRLGLPGEKVYVNLDRFGNTSAASIPLALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + GR+K  D ++ +A GGG T G+ L+RW
Sbjct: 295 EANRSGRIKPNDVVVFDAFGGGLTWGSALVRW 326


>gi|227326849|ref|ZP_03830873.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 317

 Score =  286 bits (731), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 202/321 (62%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  + +N+DLE +V+T+D WI  R GI  R IA  DE  A++G  AA+ AL  A
Sbjct: 7   GTGSYLPEEIRTNADLEKMVETTDEWIVTRTGIRERRIAAPDENVATMGYRAAQKALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   ++ L+IVAT++    FPS+A  +Q  LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  NVDPSEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +VIGSDT SR +D  DR T +LFGDGAGA++L   E         GILST+L
Sbjct: 127 KSGAVKYALVIGSDTLSRTLDPEDRGTLILFGDGAGAVLLTPSE-------QPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P   R    T   + M G  VFK AV +   ++E+   +  L   
Sbjct: 180 HADGRYGELLTL---PHQDRNHADTPAYLTMAGNEVFKVAVTELAHIVEETLQAAQLDKS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|260912837|ref|ZP_05919323.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Pasteurella dagmatis
           ATCC 43325]
 gi|260633215|gb|EEX51380.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Pasteurella dagmatis
           ATCC 43325]
          Length = 317

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 207/322 (64%), Gaps = 8/322 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP+ + +N+DLE +V+TSD WI  R GI  R IA  +ET A++G  AA+  
Sbjct: 3   SKILSTGSYLPKNIRTNADLEKMVETSDEWISERTGIKERRIADVNETVATMGFQAAKKC 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  + + V++IDLI+VAT++    FPS A  IQ  L +K   AFD+ A CSGFVYA+T A
Sbjct: 63  LEMSPIDVNEIDLIVVATTSSTYAFPSAACQIQKMLDIKDAIAFDVAAACSGFVYALTVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IR+G V++ +VIG+D FSR ++  DR T +LFGDGAGA+ILE       S  + GI+
Sbjct: 123 DQFIRTGKVKKALVIGADLFSRALNPEDRGTIILFGDGAGAVILE-------STNEPGII 175

Query: 184 STYLCSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           ST+L + G   D L + +           + M+G A FK AV +   ++E+  ++  L  
Sbjct: 176 STHLHATGENADVLTLANQARGIESDPAYLEMQGNATFKIAVRELANVVEETLEANQLDK 235

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
           ++IDW VPHQAN RII++   K+ +   +V+VT+D HGNTSA SIP AL  AV++GR+K+
Sbjct: 236 KDIDWLVPHQANLRIISATAKKLDMDMSQVVVTLDRHGNTSAGSIPSALDEAVRDGRIKR 295

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  LLLEA GGG T G+ L+R+
Sbjct: 296 GQLLLLEAFGGGLTWGSALVRF 317


>gi|218709016|ref|YP_002416637.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio splendidus
           LGP32]
 gi|218322035|emb|CAV18074.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein [Vibrio
           splendidus LGP32]
          Length = 316

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 213/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +V+TSD WI  R GI  R I+ ++ET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIKERRISAENETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKEDIDLIIVATTSSSHTFPSSACQVQGKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I++G+ + V+VIG+D  S+  D +DRST +LFGD AGA+++   E       + G
Sbjct: 121 VADQHIKTGMCKNVLVIGADALSKTCDPTDRSTIILFGDAAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ SDG Y + L ++           + M G  VFK AV +  +L++    + ++ 
Sbjct: 174 ILSTHIYSDGKYGELLSLEVPERGGAADKWLHMAGNEVFKVAVTQLSKLVKDTLAANNMD 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLTMSLDQVVITLDKHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|261822064|ref|YP_003260170.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pectobacterium
           wasabiae WPP163]
 gi|261606077|gb|ACX88563.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pectobacterium
           wasabiae WPP163]
          Length = 317

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 201/321 (62%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  + +N+DLE +V+T+D WI  R GI  R IA  DE  AS+G  AA+ AL  A
Sbjct: 7   GTGSYLPEEIRTNADLEKMVETTDEWIVTRTGIRERRIAAPDENVASMGYRAAQKALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   ++ L+IVAT++    FPS+A  +Q  LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  NVDASEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +VIGSD  SR +D  DR T +LFGDGAGA++L   E         GILST+L
Sbjct: 127 KSGAVKYALVIGSDALSRTLDPEDRGTLILFGDGAGAVLLTPSE-------QPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P   R    T   + M G  VFK AV +   ++E+   +  L   
Sbjct: 180 HADGRYGELLTL---PHQDRNHTDTPAYLTMAGNEVFKVAVTELAHIVEETLQAAQLDKS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|119897914|ref|YP_933127.1| 3-oxoacyl-(acyl carrier protein) synthase III [Azoarcus sp. BH72]
 gi|166233356|sp|A1K5Y5|FABH_AZOSB RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|119670327|emb|CAL94240.1| probable 3-oxoacyl-(acyl-carrier-protein) synthase III [Azoarcus
           sp. BH72]
          Length = 321

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 156/326 (47%), Positives = 225/326 (69%), Gaps = 11/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESI-VDTSDGWIKRRVGISRRHIAGKDETTASLGEAA 59
           MI + + G G  LP   +SN DL +  +DTSD W+  R GI  R++A  D  ++ L   A
Sbjct: 1   MIHARIAGTGSYLPGNPVSNDDLVARGIDTSDDWVVSRTGIRTRYLAPPDVGSSDLALVA 60

Query: 60  ARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVY 118
           A+ A+  A  + +DIDLIIVATSTPD  FPSTA  +Q++LG+   G AFD+QAVCSGFVY
Sbjct: 61  AQRAIEAAGCAANDIDLIIVATSTPDYIFPSTATLLQSKLGIGNNGAAFDVQAVCSGFVY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ A+ +IRSG  +R +V+G++ FSRI+DW+DR+TCVLFGDGAGA++LE  E       
Sbjct: 121 ALSIAEKFIRSGSHKRALVVGAEVFSRILDWTDRATCVLFGDGAGAVVLEASE------- 173

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             G+L+T L +DGS+   L V G  +T + VG   +RM+G+AVFK+AV+   ++  +V D
Sbjct: 174 RPGVLTTALHADGSHHPILCVPGNVATGQVVGDPFLRMDGQAVFKFAVKVLGDVAHEVLD 233

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
           +  +  +++DW +PHQAN RII +   ++ +  +KV+ TVD HGNTSAASIPLAL +AV+
Sbjct: 234 AAGVAADSVDWLIPHQANIRIIQATAKRLGLSMEKVVATVDRHGNTSAASIPLALDLAVR 293

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLL 322
           +GR++ G  +++E +GGGFT G  L+
Sbjct: 294 DGRIRPGQRVVVEGVGGGFTWGAALI 319


>gi|227111677|ref|ZP_03825333.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 317

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 202/321 (62%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  + +N+DLE +V+T+D WI  R GI  R IA  DE  A++G  AA+ AL  A
Sbjct: 7   GTGSYLPEEIRTNADLEKMVETTDEWIVTRTGIRERRIAAPDENVATMGYRAAQKALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   ++ L+IVAT++    FPS+A  +Q  LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  NVDPSEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +VIGSDT SR +D  DR T +LFGDGAGA++L   E         GILST+L
Sbjct: 127 KSGAVKYALVIGSDTLSRTLDPEDRGTLILFGDGAGAVLLTPSE-------QPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P   R    T   + M G  VFK AV +   ++E+   +  L   
Sbjct: 180 HADGRYGELLTL---PHQDRNHTDTPAYLTMAGNEVFKVAVTELAHIVEETLQAAQLDKS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|219849850|ref|YP_002464283.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus
           aggregans DSM 9485]
 gi|219544109|gb|ACL25847.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus
           aggregans DSM 9485]
          Length = 342

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 217/329 (65%), Gaps = 14/329 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + V G G+++P RV++N DL   +DTSD WI+ R GI  R +AG  E+T++   AA R+A
Sbjct: 15  AAVIGWGMAVPNRVVTNDDLAQRIDTSDEWIRTRTGIRERRVAGPGESTSTFATAAGREA 74

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +S   ID +IVAT TPD+ FP+TA  +Q  L + R  AFD+ A CSGFVY +T A
Sbjct: 75  LEMAGVSPATIDTVIVATCTPDRPFPATACTVQANLQIPRATAFDLAAACSGFVYGLTVA 134

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
            S I+SGV RR+++IG+D F+  ++W+DR+TCVLFGDGAGA++LE  +         G++
Sbjct: 135 TSLIKSGVSRRLLLIGADIFTHYINWNDRNTCVLFGDGAGAVVLEATD------EPLGLI 188

Query: 184 STYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVF 235
           ++ L +DG+  D + VD G    P T+  +      + M G+ +FK+AV +  E    V 
Sbjct: 189 ASNLSADGNLEDLMAVDAGGTRMPLTAELLAEGRQYVYMNGREIFKHAVREMSESALHVV 248

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
            +  LTI++I   +PHQAN RII+++  ++++P ++V++ +D +GNTSAASIP+AL  A 
Sbjct: 249 QAAGLTIDDIALVIPHQANVRIIDAVARRLELPPERVMINLDRYGNTSAASIPIALYEAA 308

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++ R+K GD +L+ A GGG T G+ ++RW
Sbjct: 309 QQERIKAGDYVLMTAFGGGLTWGSGIVRW 337


>gi|121533809|ref|ZP_01665636.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermosinus
           carboxydivorans Nor1]
 gi|121307800|gb|EAX48715.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermosinus
           carboxydivorans Nor1]
          Length = 338

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 151/327 (46%), Positives = 207/327 (63%), Gaps = 14/327 (4%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + G+G  +P +VL+N DLE +VDTSD WI  R GI  R IA  D  T+ L   AA  AL 
Sbjct: 10  ILGLGCYVPEKVLTNHDLEKMVDTSDEWIVERTGIRERRIADPDVATSDLATRAAERALS 69

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
           +A +S D++DLIIVAT+TPD  FPS A  +Q+ L   R  AFD+ A CSGFVY +T    
Sbjct: 70  NAGISADELDLIIVATATPDMFFPSVACLVQDNLKATRAAAFDLVAGCSGFVYGLTVGAQ 129

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           +I++G+ ++V+VIG++T S+I+DW+DR+TCVLFGDGAGA +L   E         G++  
Sbjct: 130 FIKTGLYKKVLVIGAETLSKILDWTDRNTCVLFGDGAGAAVLSETE------PGYGLIGF 183

Query: 186 YLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           +L +DGS  D L +  G    P +  TV      + M G  VFK+AV    E   K  ++
Sbjct: 184 HLGADGSGGDLLKLPAGGSRLPPSVETVTQRLHFVHMNGNEVFKFAVRVMGEAAVKALEN 243

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             L  +++D  +PHQAN RII S   ++K+P DKVIV VD +GNTSAASIP+AL  AV+ 
Sbjct: 244 AGLGHQDVDCLIPHQANIRIIQSAAKRLKLPMDKVIVNVDKYGNTSAASIPIALEEAVRN 303

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GRVKKGD ++L   G G T  + +++W
Sbjct: 304 GRVKKGDVVVLVGFGAGLTWASCVIKW 330


>gi|145599132|ref|YP_001163208.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia pestis
           Pestoides F]
 gi|166233408|sp|A4TLS3|FABH_YERPP RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|145210828|gb|ABP40235.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia pestis
           Pestoides F]
          Length = 316

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 203/321 (63%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA   
Sbjct: 3   TKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVATMGFQAAEKT 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  DDI LIIVAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ A
Sbjct: 63  LEMAGIDKDDIGLIIVATTSSSHAFPSSACQVQRMLGIKDAASFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D Y++SG V+  +VIGSD  SR +D  DR T +LFGDGAGA++L   E         GI+
Sbjct: 123 DQYVKSGAVKHAIVIGSDVLSRALDPEDRGTIILFGDGAGAVVLGASE-------QPGIM 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +DG Y + L +            + M G  VFK AV +   ++++   + +L   
Sbjct: 176 STHLHADGRYGELLALPYPDRQQDQPAYVTMAGNEVFKVAVTELAHIVDETLQANNLDRT 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV++T+D HGNTSAAS+P A   AV++GR+++G
Sbjct: 236 ALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPSAFDEAVRDGRIQRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 296 QLVLLEAFGGGFTWGSALVRF 316


>gi|253573481|ref|ZP_04850824.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251847009|gb|EES75014.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 332

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 207/325 (63%), Gaps = 14/325 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  +P +VL+N+DLE IVDT+D WI  R GI  RHIA  D+ ++ L   AA  AL  A
Sbjct: 14  GTGKYVPEKVLTNADLEKIVDTNDEWIVSRTGIKERHIAAPDQASSDLAYEAAVRALDSA 73

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +++DLIIVAT TPD  FPSTA  +Q++LG K+  AFD+ A CSGFVY +  A+ +I
Sbjct: 74  GLRAEELDLIIVATITPDMAFPSTACILQDKLGAKKAAAFDLSAACSGFVYGMAAANGFI 133

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G+ R  +VIG DT SRI D++DR+TCVLFGDGAGA++L      G      G LS  L
Sbjct: 134 QTGMYRNALVIGVDTLSRITDYTDRNTCVLFGDGAGAVVL------GEVPEGRGFLSFDL 187

Query: 188 CSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
            ++G+  + L ++ G    P++  TV      I M G+ VFK+AV       E+V     
Sbjct: 188 GAEGAGGELLKLEAGGSRLPASEATVADRKHYIYMNGREVFKFAVRVMGTATEEVLRKAG 247

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
            T E+ID FVPHQAN RII S  +++ +P +K ++ VD + NTSAASIPLAL  A ++GR
Sbjct: 248 KTKEDIDLFVPHQANIRIIQSARERLNLPEEKCVINVDKYANTSAASIPLALVEAAEDGR 307

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +K+GD +LL   GGG T G  +L W
Sbjct: 308 MKEGDTILLVGFGGGLTWGASVLVW 332


>gi|300716232|ref|YP_003741035.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Erwinia billingiae
           Eb661]
 gi|299062068|emb|CAX59184.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Erwinia billingiae
           Eb661]
          Length = 317

 Score =  285 bits (729), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 146/318 (45%), Positives = 206/318 (64%), Gaps = 8/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  R IAG DET AS+G  AA  AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERRIAGPDETVASMGFHAAERALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +DI LI+VAT++    FPS+A  IQ  L ++   +FD+ A C+GF YA++ AD YI
Sbjct: 67  GIDKNDIGLIVVATTSSSHAFPSSACMIQQLLEIEDAASFDLAAACAGFTYALSVADQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G V+  +VIG+D  +R++D  DR T +LFGDGAGA++L   E       + GI+ST+L
Sbjct: 127 KNGAVKNALVIGADVLARMLDPEDRGTIILFGDGAGAVVLGASE-------EQGIISTHL 179

Query: 188 CSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            +DG Y   L + +      +    + M G  VFK AV +   ++E+   + +L  E ID
Sbjct: 180 HADGRYGQLLTLSNQDRQNQQQPSYVTMAGNEVFKVAVTELAHIVEETLQANNLDREAID 239

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           W VPHQAN RII++   K+ +  +KV+VT+D HGNTSAAS+P AL  AV++GR+++G  +
Sbjct: 240 WLVPHQANLRIISATARKLGMGMEKVVVTLDRHGNTSAASVPTALDEAVRDGRIQRGQLI 299

Query: 307 LLEAMGGGFTSGTVLLRW 324
           LLEA GGGFT G+ L+R+
Sbjct: 300 LLEAFGGGFTWGSALVRF 317


>gi|253688882|ref|YP_003018072.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251755460|gb|ACT13536.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 317

 Score =  285 bits (729), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 203/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP ++ +N+DLE +V+T+D WI  R GI  R IA  DE  A++G  AA+ AL  A
Sbjct: 7   GTGSYLPEQIRTNADLEKMVETTDEWIVTRTGIRERRIAAPDENVATMGYRAAQKALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   ++ L+IVAT++    FPS+A  +Q  LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  NVDPSEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G V+  +VIGSDT SR +D  DR T +LFGDGAGA++L   E         GILST+L
Sbjct: 127 KNGAVKYALVIGSDTLSRTLDPEDRGTLILFGDGAGAVLLTPSE-------QPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P   R    T   + M G  VFK AV +   ++E+   +  L   
Sbjct: 180 HADGRYGELLAL---PHQDRNHAETPAYLTMAGNEVFKVAVTELAHIVEETLQAAQLDKS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|238795964|ref|ZP_04639476.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia mollaretii
           ATCC 43969]
 gi|238720169|gb|EEQ11973.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia mollaretii
           ATCC 43969]
          Length = 317

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 207/325 (63%), Gaps = 14/325 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  A
Sbjct: 3   TKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVATMGFHAAEKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  DDI LIIVAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ A
Sbjct: 63  LEMAGIDKDDIGLIIVATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D Y++SG V+  +VIGSD  SR ++  DR T +LFGDGAGA++L   E         GI+
Sbjct: 123 DQYVKSGAVKHAIVIGSDVLSRALNPEDRGTIILFGDGAGAVVLGASE-------QPGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ST+L +DG Y + L +   P  +R        + M G  VFK AV +   ++++   + +
Sbjct: 176 STHLHADGRYGELLAL---PYQNRQQQDQPAYVTMAGNEVFKVAVTELAHIVDETLQANN 232

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           L    +DW VPHQAN RII++   K+ +  DKV++T+D HGNTSAAS+P A   AV++GR
Sbjct: 233 LDRSALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAAFDEAVRDGR 292

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G  +LLEA GGGFT G+ L+R+
Sbjct: 293 IQRGQLVLLEAFGGGFTWGSALVRF 317


>gi|163847960|ref|YP_001636004.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus
           aurantiacus J-10-fl]
 gi|222525840|ref|YP_002570311.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus sp.
           Y-400-fl]
 gi|163669249|gb|ABY35615.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus
           aurantiacus J-10-fl]
 gi|222449719|gb|ACM53985.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Chloroflexus sp.
           Y-400-fl]
          Length = 334

 Score =  285 bits (728), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 218/329 (66%), Gaps = 14/329 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + V G G+++P+R+++N +L   +DTSD WI+ R GI  R +AG  E+T++L  AA R+A
Sbjct: 7   AAVIGWGMAVPQRLITNDELAQRIDTSDEWIRTRTGIRERRVAGPGESTSTLATAAGREA 66

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +S   ID +IVAT TPD+ FP+TA  +Q  L + R  AFD+ A CSGFVY +T A
Sbjct: 67  LTMAGVSPATIDTVIVATCTPDRPFPATACTVQANLQIPRATAFDLAAACSGFVYGLTVA 126

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
            S I+SGV RR+++IG+D F+  ++W+DR+TCVLFGDGAGA++LE  +         G+L
Sbjct: 127 TSLIKSGVSRRLLLIGADIFTHYINWNDRNTCVLFGDGAGAVVLEATD------EPLGLL 180

Query: 184 STYLCSDGSYIDKLYVDGG----PSTSRTVGCIR----MEGKAVFKYAVEKAVELIEKVF 235
           ++ L ++G   D + VD G    P T+  +   R    M G+ +FK+AV +  +   +V 
Sbjct: 181 ASTLSANGELEDLMAVDAGGTRMPLTADLLEAGRQYVYMNGREIFKHAVREMSDSALQVI 240

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
               LT+++I   +PHQAN RII+++  +++IP ++V+V +D +GNTSAASIP+AL  A 
Sbjct: 241 QDAGLTVDDIALVIPHQANVRIIDAVARRLEIPPERVMVNLDRYGNTSAASIPIALYEAA 300

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++ R+K GD +LL A GGG T G+ L+RW
Sbjct: 301 QQERIKAGDNVLLTAFGGGLTWGSGLVRW 329


>gi|307246307|ref|ZP_07528386.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307255291|ref|ZP_07537104.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307259726|ref|ZP_07541447.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852777|gb|EFM85003.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306861740|gb|EFM93721.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306866194|gb|EFM98061.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 316

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 213/324 (65%), Gaps = 13/324 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP ++ +N+DLE +VDTSD WI  R G+  R IA  DET A++G  AA++A
Sbjct: 3   SKILATGSYLPAQIRTNADLEKMVDTSDEWIFTRSGMKERRIAATDETVATMGAQAAKNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  ++IDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA++ A
Sbjct: 63  LEIANIDHNEIDLIVVGTTTNSHAYPSAACQIQGMLDIQDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IRSG V++ +VIGSD  SR +D +DRST VLFGDGAGA+ILE  E       + GI+
Sbjct: 123 DQFIRSGKVKKALVIGSDLNSRALDETDRSTVVLFGDGAGAVILEASE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR---TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ST+L S     D  Y+   P+  R     G I+M+G A FK AV +   ++E+  ++ +L
Sbjct: 176 STHLHSSS---DTEYMLALPAQKRGDEKSGFIQMQGNATFKLAVGQLSSVVEETLEANNL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+
Sbjct: 233 QKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKYGNNSAATVPVALDEAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LLLEA GGG+T G+ L+R+
Sbjct: 293 QRGQLLLLEAFGGGWTWGSALVRF 316


>gi|309789633|ref|ZP_07684214.1| hypothetical protein OSCT_0165 [Oscillochloris trichoides DG6]
 gi|308228369|gb|EFO82016.1| hypothetical protein OSCT_0165 [Oscillochloris trichoides DG6]
          Length = 334

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 141/329 (42%), Positives = 212/329 (64%), Gaps = 14/329 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G+++PR+V++N DL   +DTSD WI+ R GI+ R +A  DE T+ L  AA R+A
Sbjct: 7   AAIVGWGMAVPRQVVTNDDLAQRIDTSDEWIRTRTGIAERRVAAPDEYTSVLATAAGREA 66

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           +  A ++  DID++I+ T TPD+ FP TA  +Q  LG+ R  AFD+ A CSGFVY +T A
Sbjct: 67  IAQAGLAPTDIDMVILCTCTPDRPFPGTACVVQTNLGIPRAPAFDLVAACSGFVYGMTVA 126

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
            S I+SGV R +++IG+D F+  +DW+DR+TCVLFGDGAGA++L+  E +       G+L
Sbjct: 127 HSMIQSGVSRNLLLIGADIFTHFLDWNDRNTCVLFGDGAGAVVLQATEQR------VGLL 180

Query: 184 STYLCSDGSYIDKLYVDGG----PSTSRTVGC----IRMEGKAVFKYAVEKAVELIEKVF 235
           S  + + G     + V+ G    P+T   +      + M G+ +FK AV    E   +  
Sbjct: 181 SARIGAAGEGEAMMAVEAGGTRMPATPEVLAAGKQYVFMHGREIFKNAVRDMSESALQAI 240

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
               LT+++I   VPHQAN RII ++  ++ +P ++V+V +D +GNTSAAS+P+AL  A 
Sbjct: 241 AEAGLTLDDIRLVVPHQANLRIIEAVAKRLDMPMERVMVNLDRYGNTSAASVPIALCEAA 300

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++GR+K GD +LL A GGG T G+V++RW
Sbjct: 301 QQGRIKDGDYVLLTAFGGGLTWGSVVIRW 329


>gi|149194089|ref|ZP_01871187.1| 3-oxoacyl-(acyl carrier protein) synthase [Caminibacter
           mediatlanticus TB-2]
 gi|149136042|gb|EDM24520.1| 3-oxoacyl-(acyl carrier protein) synthase [Caminibacter
           mediatlanticus TB-2]
          Length = 321

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 209/321 (65%), Gaps = 17/321 (5%)

Query: 9   IGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAE 68
           IG  +P ++L+N DLE IVDT+D WI +R GI  RHI  ++E T+ L   AA D L +A 
Sbjct: 8   IGAYVPPKILTNKDLEKIVDTTDEWITKRTGIKTRHIV-ENEVTSDLAYKAALDTLKNAS 66

Query: 69  MSVDDIDLIIVATSTPDQ-TFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
           M  +DID+IIVAT TPD  T PSTA  +  +LG+ R  A D+ A C+GF+YA+  A ++I
Sbjct: 67  MKPEDIDMIIVATITPDYFTMPSTACVVAQKLGIVRP-AVDISAACTGFIYALAHAKAFI 125

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG+ + V++IG++T S+IV+W DR+TCVLFGDGAGA I+   E K  ++ D  I     
Sbjct: 126 ESGMYKNVLIIGAETLSKIVNWKDRTTCVLFGDGAGAAIISATENKNEAIIDIDI----- 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGC------IRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
            +DG Y D L     P      GC      + M+G   FK AV+   + +  +    ++T
Sbjct: 181 NADGKYQDYLIT---PGRGVKYGCKTDRIWLEMKGNETFKVAVKTLSQSVTDILKRNNMT 237

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +NIDWF+PHQAN+RII+++   +K+P +K ++TV  +GNTS+ASIP+A+    KEG++K
Sbjct: 238 SDNIDWFIPHQANYRIIDAVARAIKMPNEKSVLTVHKYGNTSSASIPMAINDMFKEGKLK 297

Query: 302 KGDCLLLEAMGGGFTSGTVLL 322
           KGD +LL+A GGGFT G+ LL
Sbjct: 298 KGDIMLLDAFGGGFTWGSALL 318


>gi|95929576|ref|ZP_01312318.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Desulfuromonas
           acetoxidans DSM 684]
 gi|95134273|gb|EAT15930.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Desulfuromonas
           acetoxidans DSM 684]
          Length = 326

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 211/332 (63%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M ++ + G G   P +VL+N DLE +VDT++ WI  R GI  R IA   E T+ L   AA
Sbjct: 1   MKKARIIGTGSYRPEKVLTNFDLEKMVDTNNEWITARTGIKERRIAADHEMTSDLAVNAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  AE   ++IDL+IV T T D  +PSTA  +Q++LG     A+D+ A CSGFVYA+
Sbjct: 61  RKALEMAETKPEEIDLVIVGTITGDYPWPSTACLVQDKLGAVNAAAWDVSAACSGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
            +A  Y+ SG  ++ +VIG++  SRI+DW DR+TC+LFGDGAGA++LE  E       + 
Sbjct: 121 ASATQYLESGHSKKALVIGAEVLSRIIDWEDRNTCILFGDGAGAVVLEAQE------GEQ 174

Query: 181 GILSTYLCSDGSYIDKLYVDG----GPST----SRTVGCIRMEGKAVFKYAVEKAVELIE 232
           G+LST+L SDGSY + LY  G     P++     + +  +RM G  VFK AV    ++  
Sbjct: 175 GVLSTHLHSDGSYWELLYQPGFGARHPASVSGIEQRLPFLRMAGNEVFKVAVRSLYDVAI 234

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +  D+  +T +++D   PHQAN RI++++  ++K+  D++ V VD+ GNTS ASIPLAL 
Sbjct: 235 EALDANQMTAKDVDLLFPHQANRRILDAVKKRLKLNDDQMYVNVDMCGNTSGASIPLALD 294

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + G++ +GD LL +A GGGFT G  L+RW
Sbjct: 295 EANRNGQLNEGDVLLFDAFGGGFTWGAALVRW 326


>gi|319956061|ref|YP_004167324.1| 3-oxoacyl-(acyl-carrier-protein) synthase iii [Nitratifractor
           salsuginis DSM 16511]
 gi|319418465|gb|ADV45575.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Nitratifractor
           salsuginis DSM 16511]
          Length = 338

 Score =  285 bits (728), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 146/333 (43%), Positives = 212/333 (63%), Gaps = 16/333 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           I +++R IG  +P ++LSN DLE IVDT+D WI +R GI  RHIA  D  T+ L   AAR
Sbjct: 7   IYASMRSIGAYVPPKILSNEDLEKIVDTTDEWIVKRTGIKERHIADSDVATSDLAVEAAR 66

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQ-TFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           DA+  AE+ V+DIDL++ AT TPD    P+TA  I N+LG+K   AFD+ A CSGFVY +
Sbjct: 67  DAIARAELEVEDIDLVLCATVTPDYFNMPATACIISNKLGIKNVQAFDISAACSGFVYGL 126

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A ++I SG+ R V++IG++ FS IVD++DRSTC+LFGDGAGA +     +  +   D 
Sbjct: 127 SIAKAFIESGMKRNVLLIGAEKFSSIVDYTDRSTCILFGDGAGAAV-----ISATQDPDE 181

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC---------IRMEGKAVFKYAVEKAVELI 231
            I+  +  +DGSY D L +   P +     C         ++M+G   FK AV+   + +
Sbjct: 182 RIIDIHASADGSYADFL-MTPSPGSVNPASCEAIEQGLQYVKMKGNETFKLAVKTLTKDV 240

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
            ++ +   +  E ID FVPHQAN+RII ++ D +K+  D+++ TV  +GNTSAASIP+A+
Sbjct: 241 REILEKNEIPAEKIDHFVPHQANYRIIKAVGDALKMRDDQIVRTVHKYGNTSAASIPMAI 300

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
               +EGR++ GD +LL+  GGG T  + LL +
Sbjct: 301 NDIYEEGRLRYGDLMLLDTFGGGLTWASALLPF 333


>gi|50120728|ref|YP_049895.1| 3-oxoacyl-(acyl carrier protein) synthase III [Pectobacterium
           atrosepticum SCRI1043]
 gi|56748943|sp|Q6D690|FABH_ERWCT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|49611254|emb|CAG74700.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Pectobacterium
           atrosepticum SCRI1043]
          Length = 317

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 201/321 (62%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP  + +N+DLE +V+T+D WI  R GI  R IA  DE  A++G  AA+ AL  A
Sbjct: 7   GTGSYLPEEIRTNADLEKMVETTDEWIVTRTGIRERRIAAPDENVATMGYRAAQKALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +   ++ L+IVAT++    FPS+A  +Q  LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  NVDASEVGLLIVATTSSSHAFPSSACQVQQLLGIKDTIAFDLAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +VIGSDT SR +D  DR T +LFGDGAGA++L   E         GILST+L
Sbjct: 127 KSGAVKYALVIGSDTLSRTLDPEDRGTLILFGDGAGAVLLTTSE-------QPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRT----VGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P   R        + M G  VFK AV +   ++E+   +  L   
Sbjct: 180 HADGRYGELLTL---PHQDRNHTDKPAYLTMAGNEVFKVAVTELAHIVEETLQAAQLDKS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMGMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|311280003|ref|YP_003942234.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Enterobacter cloacae
           SCF1]
 gi|308749198|gb|ADO48950.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Enterobacter cloacae
           SCF1]
          Length = 317

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 209/321 (65%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  R IA  +ET A++G  AA+ AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERRIAAPNETVATMGLEAAKRALDMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  + I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDAEQIGLIVVATTSATHAFPSAACQIQSMLGVKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           RSG V+  +VIGSD  +R  D +DR T ++FGDGAGA++L       S+  + GI+ST+L
Sbjct: 127 RSGAVKHALVIGSDVLARTCDPTDRGTIIIFGDGAGAVVL-------SASDEPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG+Y + L +   P+  R        + M G  VFK AV++   ++E+   + +L   
Sbjct: 180 HADGNYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVKELANIVEETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RII++   K+ +P D V+VT+D HGNTSAAS+P A   AV++GR+K+G
Sbjct: 237 DLDWLVPHQANLRIISATAKKLGMPMDNVVVTLDRHGNTSAASVPCAFDEAVRDGRIKRG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|260896169|ref|ZP_05904665.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein 1 [Vibrio
           parahaemolyticus Peru-466]
 gi|308088050|gb|EFO37745.1| 3-oxoacyl-[acyl-carrier-protein] synthase III protein 1 [Vibrio
           parahaemolyticus Peru-466]
          Length = 310

 Score =  284 bits (727), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 210/317 (66%), Gaps = 7/317 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRIAAEDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDGAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST++ +DG + D L +            + M G  VFK AV +  +L++   ++  + 
Sbjct: 174 IISTHIYADGQFGDLLSLPVPERGKDVDKWLHMAGNEVFKVAVTQLSKLVKDTLEANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V+VT+D HGNTSAA++P AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVVTLDRHGNTSAATVPTALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSG 318
           +G  LLLEA GGGFT G
Sbjct: 294 RGQTLLLEAFGGGFTWG 310


>gi|300704621|ref|YP_003746224.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia
           solanacearum CFBP2957]
 gi|299072285|emb|CBJ43618.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III) (KAS III) [Ralstonia solanacearum
           CFBP2957]
          Length = 326

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 211/325 (64%), Gaps = 15/325 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP + ++N +L     E  ++TSD WI  R GI  RH A  D T + L   AA  
Sbjct: 9   GTGSYLPPKRVTNHELAAQLAEKGIETSDEWIVTRSGIRARHYAEPDVTCSDLAVKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   +ID+I+VATSTPD  FPS A  +Q +LG+     AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRAEIDMILVATSTPDFVFPSAACLVQQKLGLSNHCAAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IR+G  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L+  +       + G
Sbjct: 129 TADKFIRAGGCRNVLVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS+ D L V G  +     G   + M+G+AVFK AV    ++  +     +
Sbjct: 182 ILSTALHADGSHADILCVPGNVAAGAIKGSAFLYMDGQAVFKLAVNVLDKVAREALGLAN 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    IDW +PHQAN RI+     K+ +P ++++VTVD HGNTSAASIPLAL  AV++GR
Sbjct: 242 VEASQIDWLIPHQANIRIMQGTAKKLGLPNERMVVTVDEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++KG  +LLE +GGGFT G  LLR+
Sbjct: 302 IQKGHHVLLEGVGGGFTWGAALLRF 326


>gi|206603809|gb|EDZ40289.1| 3-oxoacyl-(Acyl-carrier-protein) synthase III [Leptospirillum sp.
           Group II '5-way CG']
          Length = 341

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 208/330 (63%), Gaps = 12/330 (3%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G   P  V++N D+   V+TSD WI+ R GI  R +A   E+T+ L   A R+
Sbjct: 8   RSVILGTGSFAPENVVTNEDISRKVETSDLWIRERTGIRERRVASSGESTSDLASEAGRN 67

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A +S  D+D IIVAT+TPD TFPSTA  +Q +LG+   FAFD+ AVCSGF+YA+  
Sbjct: 68  ALRNAALSPLDLDGIIVATATPDLTFPSTACLVQAKLGIPGTFAFDVNAVCSGFMYALKI 127

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS IRSG    ++VIG++  SR VDWSDRSTC+LFGDGAGA++L     K  S    GI
Sbjct: 128 ADSMIRSGQCETLLVIGAEVMSRFVDWSDRSTCILFGDGAGAVVLG----KSQSRQSGGI 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPS-----TSRTVG---CIRMEGKAVFKYAVEKAVELIEKV 234
            +  L +DG + D ++V GG S     T R  G    IRM+G   F+ AV    E + +V
Sbjct: 184 GTVTLHADGRFWDLIHVPGGGSRNPVETERPPGNACTIRMKGSETFRMAVRTLEESVREV 243

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                + +  +DW VPHQAN RI+ ++ +++ IP  + ++ +D +GNTSAASIP+AL  A
Sbjct: 244 LKEEGVGVNEVDWVVPHQANIRILEALSERLGIPLGRFVINIDRYGNTSAASIPMALDEA 303

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++ R++ G  +LL A G G T G+ L+ W
Sbjct: 304 VQDSRIQPGHRILLTAFGSGVTWGSGLVNW 333


>gi|32035440|ref|ZP_00135406.1| COG0332: 3-oxoacyl-[acyl-carrier-protein] synthase III
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208848|ref|YP_001054073.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae L20]
 gi|165976809|ref|YP_001652402.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250777|ref|ZP_07336972.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303252443|ref|ZP_07338608.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248420|ref|ZP_07530441.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307250648|ref|ZP_07532586.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307253028|ref|ZP_07534913.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307261874|ref|ZP_07543536.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|166233355|sp|A3N232|FABH_ACTP2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|126097640|gb|ABN74468.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165876910|gb|ABY69958.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302648716|gb|EFL78907.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650382|gb|EFL80543.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306855062|gb|EFM87244.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306857320|gb|EFM89438.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306859486|gb|EFM91514.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306868421|gb|EFN00236.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 316

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 213/324 (65%), Gaps = 13/324 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP ++ +N+DLE +VDTSD WI  R G+  R IA  DET A++G  AA++A
Sbjct: 3   SKILATGSYLPAQIRTNADLEKMVDTSDEWIFTRSGMKERRIAAADETVATMGAQAAKNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  ++IDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA++ A
Sbjct: 63  LEIANIDHNEIDLIVVGTTTNSHAYPSAACQIQGMLDIQDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IRSG +++ +VIGSD  SR +D +DRST VLFGDGAGA+ILE  E       + GI+
Sbjct: 123 DQFIRSGKIKKALVIGSDLNSRALDETDRSTVVLFGDGAGAVILEASE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR---TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ST+L S     D  Y+   P+  R     G I+M+G A FK AV +   ++E+  ++ +L
Sbjct: 176 STHLHSSS---DTEYMLALPAQKRGDEKSGFIQMQGNATFKLAVGQLSSVVEETLEANNL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+
Sbjct: 233 QKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKYGNNSAATVPVALDEAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LLLEA GGG+T G+ L+R+
Sbjct: 293 QRGQLLLLEAFGGGWTWGSALVRF 316


>gi|83748455|ref|ZP_00945477.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia
           solanacearum UW551]
 gi|207725228|ref|YP_002255624.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia
           solanacearum MolK2]
 gi|207743603|ref|YP_002259995.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-acp
           synthase III) (kas III) [Ralstonia solanacearum IPO1609]
 gi|83724866|gb|EAP72022.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Ralstonia
           solanacearum UW551]
 gi|206590462|emb|CAQ37424.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-acp
           synthase III) (kas III) [Ralstonia solanacearum MolK2]
 gi|206595002|emb|CAQ61929.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-acp
           synthase III) (kas III) [Ralstonia solanacearum IPO1609]
          Length = 326

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 154/325 (47%), Positives = 210/325 (64%), Gaps = 15/325 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP + ++N +L     E  ++TSD WI  R GI  RH A  D T + L   AA  
Sbjct: 9   GTGSYLPPKRVTNHELAAQLAEKGIETSDDWIVTRSGIRARHYAEPDVTCSDLAVKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   +ID+I+VATSTPD  FPS A  +Q +LG+     AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRAEIDMILVATSTPDFVFPSAACLVQQKLGLSNHCAAFDLQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IR+G  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L+  +       + G
Sbjct: 129 TADKFIRAGGCRNVLVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS+ D L V G  +     G   + M+G+AVFK AV    ++  +      
Sbjct: 182 ILSTALHADGSHADILCVPGNVAAGAIKGSAFLYMDGQAVFKLAVNVLDKVAREALALAQ 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    IDW +PHQAN RI+     K+ +P ++++VTVD HGNTSAASIPLAL  AV++GR
Sbjct: 242 VEASQIDWLIPHQANIRIMQGTAKKLGLPNERMVVTVDEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++KG  +LLE +GGGFT G  LLR+
Sbjct: 302 IQKGHHVLLEGVGGGFTWGAALLRF 326


>gi|150390519|ref|YP_001320568.1| 3-oxoacyl-(acyl carrier protein) synthase III [Alkaliphilus
           metalliredigens QYMF]
 gi|149950381|gb|ABR48909.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Alkaliphilus
           metalliredigens QYMF]
          Length = 337

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 209/327 (63%), Gaps = 14/327 (4%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + GIG  LP RV+SN +LE  VDTSD WI+ R GI  R +A     T+ L   AA  AL 
Sbjct: 9   ITGIGSYLPERVVSNIELEKTVDTSDEWIRTRTGIGSRRVADDQTATSDLATKAAEKALA 68

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +  +D+DLIIVAT TPD  FPSTA  +Q  +G  +  AFD+ AVC+GF+YA+T A+ 
Sbjct: 69  DANIKAEDVDLIIVATCTPDMPFPSTACIVQKNIGANKASAFDVVAVCTGFLYAMTVAEQ 128

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           +I++G  R  +V+G++T +++++W DR+TCVLFGDGAGA+ L+ V+         GILS+
Sbjct: 129 FIKTGFYRNALVVGAETLTKVLNWEDRNTCVLFGDGAGAVFLQPVD------EGKGILSS 182

Query: 186 YLCSDGSYIDKLYVDGG--------PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           Y+ +DG+  D L + GG         +  + + CI M+G  VFK+AV    +    V + 
Sbjct: 183 YMGADGTKGDVLTIPGGGTRMPINKDNIDQNLHCITMDGSEVFKFAVRVMGKAALAVLEK 242

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
           ++++++ +D+ VPHQAN RII +   ++ +P DKV V +D +GN SAASIP+AL  A +E
Sbjct: 243 SNISLDEVDYLVPHQANIRIIEAAAKRLNLPMDKVHVNLDQYGNMSAASIPVALDEAYRE 302

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           G +K+ D ++L   GGG T  + +L+W
Sbjct: 303 GCIKEEDIVVLVGFGGGLTWASSVLKW 329


>gi|322513545|ref|ZP_08066645.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Actinobacillus ureae
           ATCC 25976]
 gi|322120616|gb|EFX92510.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Actinobacillus ureae
           ATCC 25976]
          Length = 316

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 144/324 (44%), Positives = 213/324 (65%), Gaps = 13/324 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP ++ +N+DLE +VDT+D WI  R G+  R IA  DET A++G  AA+ A
Sbjct: 3   SKILATGSYLPAQIRTNADLEKMVDTTDEWIFTRSGMKERRIAAADETVATMGAQAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A++  ++IDLI+V T+T    +PS A  IQ  L +K   AFD+ A C+GFVYA++ A
Sbjct: 63  LEMAKIDHNEIDLIVVGTTTNSHAYPSAACQIQGMLEIKDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D ++R+G V++ +VIGSD  SR +D +DRST VLFGDGAGA+ILE  E       + GI+
Sbjct: 123 DQFVRTGKVKKALVIGSDLNSRALDETDRSTVVLFGDGAGAVILEASE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR---TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ST+L S     D  Y+   P+  R     G I+M+G A FK AV +   ++E+  ++ +L
Sbjct: 176 STHLHSSS---DSEYMLALPAQKRGNEKSGFIQMQGNATFKLAVGQLSSVVEETLEANNL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+
Sbjct: 233 QKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKYGNNSAATVPVALDEAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LLLEA GGG+T G+ L+R+
Sbjct: 293 QRGQLLLLEAFGGGWTWGSALVRF 316


>gi|319789887|ref|YP_004151520.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermovibrio
           ammonificans HB-1]
 gi|317114389|gb|ADU96879.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermovibrio
           ammonificans HB-1]
          Length = 313

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 207/314 (65%), Gaps = 10/314 (3%)

Query: 10  GLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEM 69
           G  LP +VL+N DLE +VDTSD WI  R GI  R I+ + ETT+ +   AA  AL   + 
Sbjct: 9   GSYLPDKVLTNFDLEKMVDTSDQWITTRTGIKERRIS-EGETTSDMAAEAALRALKGRDP 67

Query: 70  SVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRS 129
             + ++LIIVAT+TPD  FPSTA  +Q ++  KR  AFD+ A C+GF+YA+ TADS +RS
Sbjct: 68  --NQVELIIVATATPDAFFPSTACKVQAKIENKRAVAFDLSAACTGFIYALYTADSIMRS 125

Query: 130 GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCS 189
             V+R +VIG++ FS+IV+W DR+TC+LFGDGAGA++LE         ++ GIL   L +
Sbjct: 126 KGVKRALVIGAERFSKIVNWKDRTTCILFGDGAGAVVLE-------QSSEEGILGFDLGA 178

Query: 190 DGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFV 249
           DGSY + L V    S       ++M+G  VFK AV   VE  ++V + T +  E +   V
Sbjct: 179 DGSYGELLAVASVGSNEEPPHYVKMKGNEVFKVAVRTMVESAQRVLEKTGVKPEEVKLLV 238

Query: 250 PHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLE 309
           PHQAN RIIN++ +++ IP +K+ + ++ +GNTSAASIP+AL  AV+EGR K+GD +L+ 
Sbjct: 239 PHQANVRIINAVAERLGIPTEKIFINLNKYGNTSAASIPIALDEAVREGRAKEGDLVLMV 298

Query: 310 AMGGGFTSGTVLLR 323
           A GGGFT G  + R
Sbjct: 299 AFGGGFTWGACVAR 312


>gi|114567368|ref|YP_754522.1| 3-oxoacyl-(acyl-carrier-protein) synthase [Syntrophomonas wolfei
           subsp. wolfei str. Goettingen]
 gi|122317686|sp|Q0AVV3|FABH_SYNWW RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|114338303|gb|ABI69151.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 332

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/331 (42%), Positives = 212/331 (64%), Gaps = 14/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           ++  + G+G SLP R+L+N +LE +VDTS+ WI  R GI  R IA KD  T+ L   AA+
Sbjct: 1   MKVQILGMGHSLPERILNNQELEQMVDTSNEWIVERTGILERRIADKDTATSDLCWQAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  +     ++DLIIV TS+PD  FPSTA  +Q+ LG +   AFD++A C+GF+YA+ 
Sbjct: 61  MALERSATEAKELDLIIVGTSSPDMLFPSTACIVQDHLGARNAAAFDVEAGCTGFIYALG 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A+ ++ S   ++++VIG+D  SR  D++DR+TCVLFGDGAGA ++      G      G
Sbjct: 121 IAEKFLLSPEYKKILVIGADLCSRFTDYTDRNTCVLFGDGAGAAVV------GKGNLGPG 174

Query: 182 ILSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIEK 233
           ILS+YL +DGS    LY+  G    P +  TV      IRM+G  +F++A +  V + EK
Sbjct: 175 ILSSYLAADGSGGKHLYMPAGGSALPPSKETVEQRLHFIRMDGNEIFRFATKIVVAVSEK 234

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           +     L+ +++D F+PHQAN RII + + +M+IP +K ++ +D  GN SAA IP+ L++
Sbjct: 235 LLSQAGLSYQDVDLFIPHQANLRIIKTAMKRMRIPAEKTLINLDHFGNMSAACIPVGLSM 294

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A + G++KKGD +L+ A G G + G +LLRW
Sbjct: 295 AEEAGKLKKGDLVLMVAFGAGLSYGGILLRW 325


>gi|167041411|gb|ABZ06163.1| putative chalcone and stilbene synthase, C-terminal domain protein
           [uncultured marine microorganism HF4000_006O13]
          Length = 321

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/327 (44%), Positives = 203/327 (62%), Gaps = 16/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP  +++N DLE  +DT+D WI+ R GI +R IA  D+ T+ L   AA  A
Sbjct: 3   SKIIATGSYLPENIVTNRDLEQQIDTTDEWIRSRTGIEQRRIASIDQNTSDLAYEAANRA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           +  AE++ + IDLIIV T TPD   P+    IQ RLG+K   AF ++A CSGF+YA+  A
Sbjct: 63  IDKAEIAAESIDLIIVGTCTPDVVTPNVGTIIQERLGIKNSAAFSVEAACSGFIYAMNIA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +I SG     +V+G+DT SRI DW+DR+TCVLF DGAGA IL+  +         GIL
Sbjct: 123 DKFICSGDASCALVVGADTLSRITDWTDRNTCVLFADGAGAAILQPSDAP-------GIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVG-------CIRMEGKAVFKYAVEKAVELIEKVFD 236
           S+ L +DG+Y D LYV  G  TSR          C+ M+G  VFK AV+    +  +   
Sbjct: 176 SSELGADGAYGDLLYVPYG--TSRKPEQPKPDDYCLHMKGNEVFKVAVKTLESITLEALA 233

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
             ++ I +IDW +PHQAN RII+S+  ++ IP +KVI+T+  HGNTSAASIPLAL   + 
Sbjct: 234 KQNMNINDIDWLIPHQANTRIIHSVAKRLSIPIEKVIITLSHHGNTSAASIPLALDEGID 293

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
            G++  GD +L+   G GFT GT++++
Sbjct: 294 SGKIDSGDTILMLGFGAGFTWGTMIIK 320


>gi|39996701|ref|NP_952652.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter
           sulfurreducens PCA]
 gi|39983582|gb|AAR34975.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter
           sulfurreducens PCA]
          Length = 325

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 210/331 (63%), Gaps = 14/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ + G G ++P +VL+N DLE +VDTSD W+  R GI  R IA   E T++    AA 
Sbjct: 1   MRARIVGTGSAVPSKVLTNFDLEKMVDTSDEWVTTRTGIKERRIAVDGEYTSTFATLAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   D+DL+IVAT TPD  FP+TA  +Q+ L   +  A+D+ A CSGF+YA+ 
Sbjct: 61  RALEMAGVKASDLDLLIVATITPDFPFPATACVVQSNLKATKAAAYDISAACSGFIYALA 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A + IRSG  R+ +VIG++  SRI+DW+DR+TC+LFGDGAGA++LE  +         G
Sbjct: 121 QASNAIRSGSARKALVIGAEVLSRIIDWTDRNTCLLFGDGAGAVVLEACD------DGHG 174

Query: 182 ILSTYLCSDGSYIDKLYVDG----GPSTSRTVGCIR----MEGKAVFKYAVEKAVELIEK 233
           +LST+L SDGSY + LY  G     P+  +T+   R    M+G  VFK AV    +   +
Sbjct: 175 VLSTHLHSDGSYWELLYQPGCGNRNPAVQKTLDDRRIYLMMQGNEVFKLAVRAMEDAALE 234

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
             D+  LT  +I  F+PHQAN RII++I  ++ +P +KV V +D  GNTSAASIPLAL  
Sbjct: 235 ALDANGLTPADISLFIPHQANRRIIDAIGKRLGLPGEKVYVNLDRFGNTSAASIPLALDE 294

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A + GR+K  D ++ +A GGG T G+ L+RW
Sbjct: 295 ANRSGRIKPNDVVVFDAFGGGLTWGSALVRW 325


>gi|238897668|ref|YP_002923347.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465425|gb|ACQ67199.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 314

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 147/323 (45%), Positives = 204/323 (63%), Gaps = 9/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +++ + G G  LP  V +NSDLE +VDTSD WI  R GI  R IA   ET AS+G  AA 
Sbjct: 1   MQTNILGTGSYLPETVRTNSDLEKMVDTSDEWIFTRTGIRERRIAASSETVASMGFYAAT 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +AL  A++  +DI LIIVAT++    FPS+A  IQ  LG+K   +FD+ A C+GF+YA++
Sbjct: 61  EALKMAQIDQNDIGLIIVATTSSSHAFPSSACQIQEMLGIKDSISFDLAAACAGFIYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD YI+SG +   +VIGSD  ++ +D  DRST +LFGD AGA++L   +         G
Sbjct: 121 VADQYIKSGTISYALVIGSDLLTQSLDLKDRSTVILFGDAAGAVVLGASD-------QPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L ++G Y  KL     P   +    I M G  VFK AV +   ++ +   S  L 
Sbjct: 174 IISTHLHANGHY-GKLLTLFYPR-EKNSPFISMAGNEVFKVAVLELASVVHEALKSNQLD 231

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW +PHQAN RIIN+   K+ I  +KV++T+D HGNTSAAS+P AL  AV++GR++
Sbjct: 232 ASELDWLIPHQANIRIINATAKKLNIGMEKVVITLDRHGNTSAASVPSALDEAVRDGRIQ 291

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGF  G+ L+R+
Sbjct: 292 RGQLLLLEAFGGGFVWGSALVRF 314


>gi|163803782|ref|ZP_02197637.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio sp. AND4]
 gi|159172423|gb|EDP57294.1| 3-oxoacyl-(acyl carrier protein) synthase [Vibrio sp. AND4]
          Length = 317

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 213/327 (65%), Gaps = 14/327 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R I+ +DET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVARTGIKERRISAQDETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  NAIDMAGIDKNDIDLIIVATTSSSHTFPSSACQVQGKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ + ++VIG+D  S+  D +DRST +LFGD AGA+++   E       + G
Sbjct: 121 VADQHIKSGMCKNILVIGADALSKNCDPADRSTIILFGDAAGAVVIGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           I+ST++ SDG + D L +   P   R        + M G  VFK AV +  +L++    +
Sbjct: 174 IISTHIYSDGQFGDLLSL---PVPERGNQEADKWLHMAGNEVFKVAVTQLSKLVKDTLAA 230

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +    +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++
Sbjct: 231 NDMHKSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATVPTALDEAVRD 290

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+K+G  LLLEA GGGFT G+ L+++
Sbjct: 291 GRIKRGQTLLLEAFGGGFTWGSALVKF 317


>gi|307826068|ref|ZP_07656281.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacter
           tundripaludum SV96]
 gi|307732907|gb|EFO03771.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Methylobacter
           tundripaludum SV96]
          Length = 322

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/325 (46%), Positives = 211/325 (64%), Gaps = 11/325 (3%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S V G G  LP  V +N  +   VDTSD WI  R GI  R IAG +ET +S+ E AAR A
Sbjct: 5   SRVIGTGGYLPEEVRTNEQISQTVDTSDSWIFERTGIKSRRIAGAEETASSMAEIAARQA 64

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           +  A    ++IDLIIVAT TPD+ +PST   +Q RLG+K   AFD+QA CSG ++A++ A
Sbjct: 65  IEAAACDPEEIDLIIVATGTPDRVYPSTGCLLQRRLGIKNCVAFDVQAACSGSIFALSIA 124

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D YI+SG  ++V+V+GS+  SR+VDW+DR TC+LFGDGAGA++L      G+S  + GIL
Sbjct: 125 DQYIKSGAAKKVLVVGSEICSRVVDWTDRGTCILFGDGAGAVLL------GAS-DEAGIL 177

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRT----VGCIRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ST++ SDG Y D LY     + +       G I M G  VFK AV     ++++   + +
Sbjct: 178 STHIHSDGEYEDLLYCPNPQAATEANKDEAGYINMRGNEVFKVAVNTLGRIVDETLAANN 237

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +   ++DW VPHQAN RII +   K+K+  D VI+T++  GNTS+AS+ LAL   V++GR
Sbjct: 238 MLQSDVDWLVPHQANTRIIAATAKKLKMSMDHVILTLENQGNTSSASVLLALNEGVRDGR 297

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++G  +LLEA G GFT G+ L+++
Sbjct: 298 IQRGQVVLLEAFGAGFTWGSALIKY 322


>gi|90406887|ref|ZP_01215078.1| 3-oxoacyl-(acyl carrier protein) synthase [Psychromonas sp. CNPT3]
 gi|90311929|gb|EAS40023.1| 3-oxoacyl-(acyl carrier protein) synthase [Psychromonas sp. CNPT3]
          Length = 319

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 142/325 (43%), Positives = 208/325 (64%), Gaps = 10/325 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP  + SNSDLE +V+TSD WI  R GI  RHIA KDET A +G+ A  
Sbjct: 1   MNSKITGTGSYLPIAIRSNSDLEKMVETSDEWITTRTGIKERHIANKDETIAFMGKEAGL 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A++   D+DLIIVAT++    FPS A  +QN LG+    AFD+ A C+GF YA++
Sbjct: 61  KALQAADLEASDLDLIIVATTSNHNAFPSAACEVQNFLGIYNIPAFDVSAACAGFAYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD++I++G  + ++VIG+DT +   D SDR T +LFGDGAGA+I+   E       + G
Sbjct: 121 IADNFIKAGSAKHILVIGADTLAATCDPSDRGTIILFGDGAGAVIVSASE-------EIG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGG---PSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
           I+ST++ +DG + + L +      P  +     + M G  VFK AV+K  +++ +   + 
Sbjct: 174 IISTHINADGRFGELLKLPNASRDPKEADKNAYLTMSGNEVFKVAVKKLSQVVVETLAAN 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           ++  E++DW VPHQAN RII++   K+ +  D+VI+T++ HGNTSAAS+PLA    ++ G
Sbjct: 234 NIAKEDLDWLVPHQANKRIISATAKKLGMSMDQVILTLESHGNTSAASVPLAFDEGIRSG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLR 323
           ++K G  +LLEA GGGFT G+ L+R
Sbjct: 294 KIKAGHLVLLEAFGGGFTWGSALIR 318


>gi|189424998|ref|YP_001952175.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter lovleyi
           SZ]
 gi|189421257|gb|ACD95655.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Geobacter lovleyi
           SZ]
          Length = 327

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 149/333 (44%), Positives = 221/333 (66%), Gaps = 15/333 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+R+ + G G ++P +VL+N DLE +VDT+D WI  R GI +R IA ++E T++    AA
Sbjct: 1   MLRARITGTGSAVPDKVLTNHDLEKLVDTNDEWITTRTGIKQRRIAAENEYTSTFATLAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +S +++DLII+ T TPD  FP+TA  +Q  LG     AFD+ A CSGF+Y +
Sbjct: 61  RRALAMAGVSPEELDLIILGTVTPDFPFPATACIVQQELGAHHAAAFDLSAACSGFIYGL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
             A++YI+SG+ R+V+V+G++  +RIVD++DR+TC+LFGDGAGA+I+E      +     
Sbjct: 121 NMAEAYIKSGMARKVLVMGAEVLTRIVDFTDRNTCILFGDGAGAVIVE------ADSGGQ 174

Query: 181 GILSTYLCSDGSYIDKLYVDG--------GPST-SRTVGCIRMEGKAVFKYAVEKAVELI 231
           GILS+++ ++G++   LY  G        GP+T S  +  +RMEG  VFK+AV    +  
Sbjct: 175 GILSSHIFTNGAHWGLLYQPGCGGRNPATGPTTYSDKLYYLRMEGNEVFKHAVRAMGDAA 234

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
               +   +T +++   +PHQAN RII +   ++ IP D++ V +  +GNTS+ASIPLAL
Sbjct: 235 VAALEHNSVTADDVSLLIPHQANRRIIEATGKRVGIPEDRIFVNLHKYGNTSSASIPLAL 294

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
             A +EGR+K GD +LL+A GGGFT G+VLLRW
Sbjct: 295 DEANREGRLKSGDLVLLDAFGGGFTYGSVLLRW 327


>gi|114777085|ref|ZP_01452105.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mariprofundus
           ferrooxydans PV-1]
 gi|114552606|gb|EAU55066.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Mariprofundus
           ferrooxydans PV-1]
          Length = 339

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 214/334 (64%), Gaps = 19/334 (5%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + GIG  LP RVL+N+DLE ++DT+D WI+ R GI +RHI  +D+ T+ L  AAA  AL 
Sbjct: 8   ITGIGGYLPERVLTNADLEKMIDTTDVWIRERTGIEQRHIIAEDQMTSDLAAAAAMQALD 67

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A ++++DID ++VAT+TPD  FPSTA  +Q++LG K   A+D+QAVCSGFVY +   D 
Sbjct: 68  DAGITINDIDALVVATTTPDMIFPSTATVVQSKLGGKDFPAWDIQAVCSGFVYGLAQVDG 127

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
            +RSG+ +RV++IG++  SRIV+W DR TC+LFGDGAGA++LE  +       D G++ +
Sbjct: 128 MMRSGMFKRVLLIGAEAMSRIVNWQDRGTCILFGDGAGAVVLEARDAS----VDYGMVGS 183

Query: 186 YLCSDGSYID--KLYVDGGPST-------------SRTVGCIRMEGKAVFKYAVEKAVEL 230
            L +DGSY D  K +    PS+             S     + M+G  VF+ AV K   +
Sbjct: 184 VLHADGSYRDLLKAHHPHPPSSPEMHHGAADFALDSAGAAAVEMKGNEVFRVAVTKLGSV 243

Query: 231 IEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLA 290
           + ++ +   L   +IDW VPHQAN RII +   K+K+  D+V +TV  HGNTS+AS+PLA
Sbjct: 244 VNEILEKYELVDSDIDWLVPHQANIRIIQATAKKLKMDMDRVALTVARHGNTSSASVPLA 303

Query: 291 LAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           L    + GR++ G  +LLEA  GGF  G  LLRW
Sbjct: 304 LNDLYRTGRLETGQLILLEAFAGGFAWGANLLRW 337


>gi|124515069|gb|EAY56580.1| 3-oxoacyl-(Acyl-carrier-protein) synthase III [Leptospirillum
           rubarum]
          Length = 341

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 207/330 (62%), Gaps = 12/330 (3%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           RS + G G   P  V++N D+   V+TSD WI+ R GI  R IA   E+T+ L   A R+
Sbjct: 8   RSIILGTGSFAPANVVTNEDISRKVETSDLWIRERTGIRERRIASSGESTSDLALEAGRN 67

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL +A +S  D+D IIVAT+TPD TFPSTA  +Q RLG+   FAFD+ AVCSGF+YA+  
Sbjct: 68  ALRNAALSPADLDGIIVATATPDLTFPSTACLVQARLGIPGTFAFDVNAVCSGFMYALKI 127

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           ADS IRSG    ++VIG++  SR VDWSDRSTC+LFGDGAGA++L     K  S    G+
Sbjct: 128 ADSMIRSGQCETLLVIGAEVMSRFVDWSDRSTCILFGDGAGAVVLG----KSGSPQTGGV 183

Query: 183 LSTYLCSDGSYIDKLYVDGGPS-----TSRTVG---CIRMEGKAVFKYAVEKAVELIEKV 234
            +  L +DG Y D ++V GG S     T +  G    IRM+G   F+ AV    E + +V
Sbjct: 184 GTVTLHADGRYWDLIHVPGGGSRSPVETEKPPGNACTIRMKGSETFRMAVRSLEESVREV 243

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                + +  +DW VPHQAN RI+ ++ +++ IP    +V +D +GNTSAASIP+AL  A
Sbjct: 244 LKEEGIGVNELDWVVPHQANIRILEALSERLGIPLGHFVVNIDRYGNTSAASIPMALDEA 303

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++ R++ G  +LL A G G T G+ L+ W
Sbjct: 304 VQDKRIQPGHRILLTAFGSGVTWGSGLVHW 333


>gi|147678080|ref|YP_001212295.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pelotomaculum
           thermopropionicum SI]
 gi|146274177|dbj|BAF59926.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Pelotomaculum
           thermopropionicum SI]
          Length = 330

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 152/332 (45%), Positives = 215/332 (64%), Gaps = 14/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           +IR+ + G+G  LP RVL+N+ LE +V+TSD WI  R GI  R IA  D+ T+ L   AA
Sbjct: 5   LIRAGIAGVGCYLPDRVLTNAHLEEMVETSDEWIITRSGIRERRIASPDQATSDLAVIAA 64

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  A +  +++D++IVAT+TPD  FP+TA  +Q+R+G KR  AFD+ A C+GF+YA+
Sbjct: 65  GRALAAAGIGPEEVDMVIVATNTPDMFFPATACLVQDRIGAKRAGAFDLAAGCTGFIYAM 124

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
                +I +G  R V+VIG++T SR+ +W DR+TCVLFGDGAGA++L        S  ++
Sbjct: 125 AVGSQFISTGASRTVLVIGAETLSRVTNWEDRNTCVLFGDGAGAVVLR------PSADES 178

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIE 232
           GIL+  L SDGS    L +  G    P+T  TV      I M G+ VFK+AV    + + 
Sbjct: 179 GILAFKLYSDGSKGPLLMMPAGGSRRPATRETVEEKLHYIHMNGREVFKFAVRIMEDAVA 238

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +V D+T L    +D+F+PHQAN RII+S   ++ +P DKV+V VD +GNTS ASIPLAL 
Sbjct: 239 EVLDATGLKESEVDFFIPHQANIRIIDSAAKRLGLPMDKVLVNVDRYGNTSTASIPLALE 298

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A + GR+KKGD +++   G G T G +++RW
Sbjct: 299 EAWRGGRIKKGDNIVMVGFGAGLTWGAMVIRW 330


>gi|240949741|ref|ZP_04754073.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus minor
           NM305]
 gi|240295773|gb|EER46460.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus minor
           NM305]
          Length = 316

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 141/321 (43%), Positives = 208/321 (64%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  +P +V +N+DLE +V+TSD WI  R G+  R IA  DET A++G  AA+  
Sbjct: 3   SKILATGSYMPAQVRTNADLEKMVETSDEWIVTRSGMKERRIAAADETVATMGFEAAKKC 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +   +IDLI+V T++    +PS A  IQ  LG+    +FD+ A C+GFVYA++ A
Sbjct: 63  LEQANLDPQEIDLIVVGTTSNSHAYPSAACQIQGMLGIDDAISFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D ++R+G V++ +V+GSD  SR +D +DR T VLFGDGAGA+ILE  E       + GI+
Sbjct: 123 DQFVRTGKVKKALVVGSDLNSRKLDETDRGTVVLFGDGAGAVILEASE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +     + L +      +   G I M+G A FK AV++  +++E+   +  L   
Sbjct: 176 STHLHASADTKESLVLPNVERGNDRSGFISMQGNATFKLAVKQLSDVVEETLSANQLDKS 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++  +K+ +  D+V+VTVD +GNTSAA+IP+AL  AV++GR+K+G
Sbjct: 236 ELDWLVPHQANLRIISATAEKLDMSMDQVVVTVDRYGNTSAATIPVALDEAVRDGRIKRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSALVRF 316


>gi|310767304|gb|ADP12254.1| 3-oxoacyl-(acyl carrier protein) synthase III [Erwinia sp. Ejp617]
          Length = 317

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 146/318 (45%), Positives = 204/318 (64%), Gaps = 8/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  AL  +
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIHERRIAGPDETVATMGFQAAMRALEMS 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +DI LI+VAT++    FPS+A  IQ  L +    +FD+ A C+GF YA++ AD YI
Sbjct: 67  GIDKNDIGLIVVATTSSSHAFPSSACMIQQMLEIDDAASFDLAAACAGFTYALSVADQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++GVV+  +VIG+D  +R++D  DR T +LFGDGAGA++L   E       + GI+ST+L
Sbjct: 127 KNGVVKNALVIGADVLARMLDPHDRGTLILFGDGAGAVVLGASE-------EQGIISTHL 179

Query: 188 CSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            +DG Y   L + +           + M G  VFK AV +   ++E+   + +L    ID
Sbjct: 180 HADGRYGQLLTLTNQDRQRQENPSYVTMAGNEVFKVAVTELAHIVEETLQANNLDRTAID 239

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           W VPHQAN RIIN+   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+++G  +
Sbjct: 240 WLVPHQANLRIINATARKLGMDMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIQRGQLV 299

Query: 307 LLEAMGGGFTSGTVLLRW 324
           LLEA GGGFT G+ L+R+
Sbjct: 300 LLEAFGGGFTWGSALVRF 317


>gi|269121073|ref|YP_003309250.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sebaldella
           termitidis ATCC 33386]
 gi|268614951|gb|ACZ09319.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Sebaldella
           termitidis ATCC 33386]
          Length = 326

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/328 (46%), Positives = 211/328 (64%), Gaps = 17/328 (5%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + GIG  LP R+L+N ++ESIVDT+D WI  R GI  R IA  DE T+ L   AA  A+ 
Sbjct: 5   ILGIGSYLPERILTNKEMESIVDTTDEWITSRTGIRERRIAADDEATSDLSYKAALKAIE 64

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +  D+I+L+IVAT+TPD + PSTA  +Q+++G+++  AFDM+A C+GFVYA+TT  S
Sbjct: 65  DAGIDKDEIELVIVATTTPDYSMPSTAAIVQDKIGIRKAAAFDMEAACTGFVYALTTGYS 124

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           +I++G+ ++V+VIG+D FSRI+DW DR TC+LFGDGAGA +L  VE  G    D      
Sbjct: 125 FIKAGIYKKVLVIGADVFSRILDWEDRGTCILFGDGAGAAVLGEVETGGYLGGD------ 178

Query: 186 YLCSDGSYIDKLYVDGGPS---------TSRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
            L +DG+   +L V    S         TSR    ++M G+ +FK+AV    E      +
Sbjct: 179 -LQADGAGAQELIVPSSGSRKPFREEVLTSRD-QFVKMNGREIFKFAVRAFPETTAVSLE 236

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L IE+ID F+PHQAN RII SI  + K P +K  V +D +GNTSAA+IP+A+  A  
Sbjct: 237 KAGLKIEDIDLFIPHQANIRIIESIAKRFKQPMEKFYVNLDKYGNTSAATIPIAIDEARN 296

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           EG++KKGD LLL   GGG T G+ +L W
Sbjct: 297 EGKIKKGDRLLLVGFGGGLTYGSCILEW 324


>gi|113460311|ref|YP_718372.1| 3-oxoacyl-(acyl carrier protein) synthase III [Haemophilus somnus
           129PT]
 gi|122945104|sp|Q0I0V6|FABH_HAES1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|112822354|gb|ABI24443.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Haemophilus somnus
           129PT]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 138/321 (42%), Positives = 212/321 (66%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  +P  + +N+DLE +V+TSD WI  R GI  R IAG++ET A++G  AA++A
Sbjct: 3   SRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIAGENETVATMGFKAAKNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  +DIDL++VAT++    +PS A  IQ  L +    +FD+ A C+GF+YA++ A
Sbjct: 63  LQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAISFDLAAACTGFIYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +I++G V++ +VIG+D  SR +D +DRST +LFGDGAGA+ILE  +++       GI+
Sbjct: 123 DQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGAVILESSDIE-------GII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +     + L +          G I+M+G A FK AV +   ++E+     HL   
Sbjct: 176 STHLHASLDKSNALILPQTQHGEAQSGYIQMQGNATFKLAVRELSNVVEETLRDNHLDKA 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RII +  +K+ +  D+V++T+D +GNTSAA++P+AL  AV++GR+K+G
Sbjct: 236 DLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPVALDEAVRDGRIKRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSALVRF 316


>gi|323499357|ref|ZP_08104333.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio sinaloensis
           DSM 21326]
 gi|323315542|gb|EGA68577.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio sinaloensis
           DSM 21326]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 213/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA ++ET A +G  AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTSDEWIVTRTGIKERRIAAENETVADMGYIAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DIDLIIVAT++   TFPS+A  +Q +L ++   AFD+ A CSGFVYA++
Sbjct: 61  NAIEMAGIDKNDIDLIIVATTSGSHTFPSSACQVQAKLDIQGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SG+ + V+VIG+D  S+  D +DRST +LFGD AGA+++   E       + G
Sbjct: 121 VADQHVKSGMCKNVLVIGADALSKTCDPTDRSTIILFGDAAGAVVVGASE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ SDG + + L ++           + M G  VFK AV +  +L++    +  + 
Sbjct: 174 ILSTHIYSDGRFGELLSLEVPERGKDADKWLHMAGNEVFKVAVTQLSKLVKDTLAANDMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDKHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQTLLLEAFGGGFTWGSALVKF 316


>gi|170718452|ref|YP_001783387.1| 3-oxoacyl-(acyl carrier protein) synthase III [Haemophilus somnus
           2336]
 gi|189037894|sp|B0UUZ0|FABH_HAES2 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|168826581|gb|ACA31952.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Haemophilus somnus
           2336]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 138/321 (42%), Positives = 212/321 (66%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  +P  + +N+DLE +V+TSD WI  R GI  R IAG++ET A++G  AA++A
Sbjct: 3   SRILATGSYIPANIRTNADLEKMVETSDEWITTRSGIKERRIAGENETVATMGFEAAKNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  +DIDL++VAT++    +PS A  IQ  L +    +FD+ A C+GF+YA++ A
Sbjct: 63  LQLANICPNDIDLVLVATTSHSYAYPSAACQIQGMLDIDDAISFDLAAACTGFIYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +I++G V++ +VIG+D  SR +D +DRST +LFGDGAGA+ILE  +++       GI+
Sbjct: 123 DQFIKTGKVKKALVIGADINSRKLDETDRSTVILFGDGAGAVILESSDIE-------GII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +     + L +          G I+M+G A FK AV +   ++E+     HL   
Sbjct: 176 STHLHASLDKSNALILPQTQQGEVQSGYIQMQGNATFKLAVRELSNVVEETLRDNHLDKA 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RII +  +K+ +  D+V++T+D +GNTSAA++P+AL  AV++GR+K+G
Sbjct: 236 DLDWLVPHQANLRIITATAEKLNMSLDQVVITLDKYGNTSAATVPVALDEAVRDGRIKRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSALVRF 316


>gi|262404378|ref|ZP_06080933.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio sp. RC586]
 gi|262349410|gb|EEY98548.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio sp. RC586]
          Length = 316

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 147/327 (44%), Positives = 217/327 (66%), Gaps = 15/327 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +V+TSD WI  R GI  R IA ++ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAAENETVADMAFYAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +  +DID+IIVAT++   TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAIEMAGIDKNDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SGV + ++VIGSD  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGVCKNILVIGSDALSKSCDPTDRSTIILFGDGAGAVVI------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVD----GGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           ILST++ +DG Y D L ++    GG S       + M G  VFK AV +  +L+     +
Sbjct: 174 ILSTHIHADGEYGDLLSLEVPVRGGDSDK----WLHMAGNEVFKVAVTQLSKLVVDTLKA 229

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +    +DW VPHQAN+RII++   K+ +  ++V+VT+D HGNTSAA++P AL  AV++
Sbjct: 230 NDMHKSELDWLVPHQANYRIISATAKKLSMSLEQVVVTLDRHGNTSAATVPTALDEAVRD 289

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+K+G  LLLEA GGGFT G+ L+++
Sbjct: 290 GRIKRGQMLLLEAFGGGFTWGSALVKF 316


>gi|145588585|ref|YP_001155182.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|189037897|sp|A4SVV4|FABH_POLSQ RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|145046991|gb|ABP33618.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 328

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 217/333 (65%), Gaps = 17/333 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I S + G G  LP   L+N DL     ++ ++TSD WI  R GIS RH A ++E T+ L 
Sbjct: 3   IFSRIAGTGSYLPELRLTNQDLVERLAKTGLETSDEWIATRSGISARHFAAENELTSDLA 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQT--FPSTAVNIQNRLGMKRGFA-FDMQAVC 113
             AA+ AL  A ++  D+DLII+ATSTPD    FPSTA  +Q++LG     A FD+QAVC
Sbjct: 63  LKAAQAALSSAGITSSDLDLIILATSTPDHLGGFPSTACVVQDKLGAHTACAAFDVQAVC 122

Query: 114 SGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVK 173
           +GF YA+ TAD++IR+G  ++V+VIG++TFSRI+D+ DR TCVLFGDGAGA++LE     
Sbjct: 123 AGFTYALATADAFIRTGSYKKVLVIGAETFSRILDFQDRGTCVLFGDGAGAVVLE----- 177

Query: 174 GSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELI 231
             + ++ GILST L +DGS  D L V G        G   + M+G+AVFK AV+   ++ 
Sbjct: 178 --ASSEPGILSTALHADGSQRDILCVPGRSGNGAVHGSPFMTMDGQAVFKLAVKVLEQVA 235

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
            +V    +L  E IDW VPHQAN RI+     KM +  DKVIVTV  HGNTSAASIPLAL
Sbjct: 236 HEVLAKANLKPEQIDWLVPHQANIRIMEGTAKKMGMSMDKVIVTVHEHGNTSAASIPLAL 295

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
              ++ G++++G  LLLE +GGGF  G V L++
Sbjct: 296 DCGIRSGQIQRGQHLLLEGVGGGFAWGAVALKY 328


>gi|313901961|ref|ZP_07835377.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermaerobacter
           subterraneus DSM 13965]
 gi|313467750|gb|EFR63248.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermaerobacter
           subterraneus DSM 13965]
          Length = 408

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 204/328 (62%), Gaps = 14/328 (4%)

Query: 5   TVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDAL 64
           T+ GIG  +P  V++N  L  +V+T D WI+ R GI +R +A  D  T+ L E AAR AL
Sbjct: 9   TIAGIGACVPPVVVTNDHLAEVVETDDEWIRTRTGIRQRRVADPDTATSDLAEVAARRAL 68

Query: 65  HHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTAD 124
             A++  + +DLIIVAT TPD  FPSTA  +Q+RLG  R   FD++A CSGFVYA+    
Sbjct: 69  EEAQVRPEQVDLIIVATVTPDMPFPSTACLLQDRLGATRAAGFDLEAACSGFVYALAAGA 128

Query: 125 SYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILS 184
            ++ +G+   V+V+G++T S+I+DWSDR TCVL GDGAGA +L        +    GIL 
Sbjct: 129 QFVAAGLYDTVLVVGAETLSKIIDWSDRRTCVLLGDGAGAAVLR------PAPPGEGILG 182

Query: 185 TYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFD 236
            YL +DGS  D L    G    P++S TV      ++M G+ VFK+AV+   +  +    
Sbjct: 183 LYLGADGSGGDLLKQPAGGSRLPASSETVARGLHYVQMNGREVFKFAVKTMGDAAQAALA 242

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L  E++D ++PHQAN+RII S   +  +P D+V+V +D +GNTSAASIP+AL  A+ 
Sbjct: 243 QAGLRFEDVDLYIPHQANYRIIESSARRFDLPLDRVVVNIDRYGNTSAASIPVALDEALS 302

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GRV+ G  +LL A GGG T G  ++RW
Sbjct: 303 AGRVRAGQTVLLVAFGGGLTWGAAVVRW 330


>gi|190150704|ref|YP_001969229.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264056|ref|ZP_07545654.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189915835|gb|ACE62087.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306870602|gb|EFN02348.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 316

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/324 (44%), Positives = 212/324 (65%), Gaps = 13/324 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP ++ +N+DLE +VDTSD WI  R G+  R IA  DET A++G  AA++A
Sbjct: 3   SKILATGSYLPAQIRTNADLEKMVDTSDEWIFTRSGMKERRIAATDETVATMGAQAAKNA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  ++IDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA++ A
Sbjct: 63  LEIANIDHNEIDLIVVGTTTNSHAYPSAACQIQGMLDIQDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IRSG V++ +VIGSD  SR +D +DRST VLFGDGAGA++LE  E       + GI+
Sbjct: 123 DQFIRSGKVKKALVIGSDLNSRALDETDRSTVVLFGDGAGAVVLEANE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR---TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ST+L S     D  Y+   P+  R     G I+M+G A FK AV +   ++E+  ++  L
Sbjct: 176 STHLHSSS---DSEYMLALPAQKRGDERSGFIQMQGNATFKLAVGQLSSVVEETLEANSL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+
Sbjct: 233 QKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKYGNNSAATVPVALDEAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LLLEA GGG+T G+ L+R+
Sbjct: 293 QRGQLLLLEAFGGGWTWGSALVRF 316


>gi|283833614|ref|ZP_06353355.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Citrobacter youngae
           ATCC 29220]
 gi|291071297|gb|EFE09406.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Citrobacter youngae
           ATCC 29220]
          Length = 317

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 207/321 (64%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +V+TSD WI  R GI  RHIA  +ET A++G AAA  AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAAPNETVATMGFAAANRALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  ++I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKEEIGLIVVATTSSTHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA++L   E       + GILST+L
Sbjct: 127 KSGAVKHALVVGSDVLARTCDPTDRGTIIIFGDGAGAVVLSASE-------EPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P+  R        + M G  VFK AV +   ++++  ++ +L   
Sbjct: 180 HADGRYGELLTL---PNADRVNPDNPIHLTMAGNEVFKVAVTELAHIVDETLEANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKAG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLILLEAFGGGFTWGSALVRF 317


>gi|260773149|ref|ZP_05882065.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio
           metschnikovii CIP 69.14]
 gi|260612288|gb|EEX37491.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio
           metschnikovii CIP 69.14]
          Length = 316

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 142/323 (43%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDT+D WI  R GI  R IA  +ET A +   AA 
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVDTNDEWIVTRTGIRERRIAADNETVADMAFYAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A++  ++IDLIIVAT++   TFPS+A  +Q +LG+K   AFD+ A CSGFVYA++
Sbjct: 61  KAIEMAQIDKNEIDLIIVATTSGSHTFPSSACQVQAKLGIKGCPAFDLAAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I+SG+ ++V+VIG+D  S+  D +DRST +LFGD AGA+++      G+S  + G
Sbjct: 121 VADQHIKSGMCKKVLVIGADALSKTCDPTDRSTIILFGDAAGAVVV------GASQ-EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + + L ++           + M G  VFK AV +  +L++    + +L 
Sbjct: 174 ILSTHIYADGEFGELLSLEVPERGGNVDKWLHMAGNEVFKVAVTQLSKLVKDTLAANNLH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSQLDWLVPHQANYRIISATAKKLSMSLDQVVMTLDRHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQLLLLEAFGGGFTWGSALVKF 316


>gi|329929591|ref|ZP_08283298.1| 3-oxoacyl-(acyl carrier protein) synthase III [Paenibacillus sp.
           HGF5]
 gi|328936236|gb|EGG32688.1| 3-oxoacyl-(acyl carrier protein) synthase III [Paenibacillus sp.
           HGF5]
          Length = 329

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 209/326 (64%), Gaps = 16/326 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  +P ++LSNSDLE +VDTSD WI    GI  RHIA  +E T+ L   AA +AL  A
Sbjct: 11  GTGKYVPEKILSNSDLEKMVDTSDEWIVSMTGIRERHIAAPNEATSDLAYHAAVNALKSA 70

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            M  +D++LIIVAT TPD  FPSTA  +Q+RLG K+  AFD+ A CSGFVY + TA +++
Sbjct: 71  GMQAEDLELIIVATITPDMFFPSTACLLQDRLGAKKAAAFDLSAACSGFVYGLATATNFV 130

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALIL-EGVEVKGSSMADTGILSTY 186
           ++G+    +VIG D  SRI D++DR+TCVLFGDGAGA I+ E  E +G    D G     
Sbjct: 131 KTGMYNNALVIGVDCLSRITDYTDRNTCVLFGDGAGAAIVGEVPEGRGFQAFDLG----- 185

Query: 187 LCSDGSYIDKLYVDGG----PSTSRTVGC----IRMEGKAVFKYAVEKAVELIEKVFDST 238
             ++G+    LY++ G    P+++ T+      I M G+ VFK+AV       E V    
Sbjct: 186 --AEGAGGAHLYIEAGGSRLPASAETINTNKHYIYMNGREVFKFAVRVMGTATEAVLSKA 243

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +  ++ID FVPHQAN RII S ++++++P +KV++ VD + NTSAAS+PLAL  A + G
Sbjct: 244 GIDKKDIDLFVPHQANIRIIKSAMERLELPEEKVVINVDKYANTSAASVPLALVEAQESG 303

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+GD +L+   GGG T G+ +L W
Sbjct: 304 RLKEGDKVLMVGFGGGLTWGSSVLIW 329


>gi|309389512|gb|ADO77392.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halanaerobium
           praevalens DSM 2228]
          Length = 329

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 215/332 (64%), Gaps = 15/332 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M R+T+ G+G  LP +V++N DLE  VDTSD WIK R GI +R IA  D+  + LG  AA
Sbjct: 1   MSRATIIGLGKYLPDKVVTNHDLEKKVDTSDEWIKTRTGIEKRRIAAADQAASDLGIKAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
             AL  AE+  +D++LIIVAT+TPD  FP+TA  IQN++G K   AFD++A CSGFVY V
Sbjct: 61  EAALEDAEIKAEDLELIIVATATPDMMFPATACIIQNKIGAKNAAAFDLEAGCSGFVYGV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + A ++I SG  + ++VIG++  S+I+DW DRSTCVLFGDGAGA +        S+  + 
Sbjct: 121 SVAANFIESGTYKNILVIGAEVLSKIMDWEDRSTCVLFGDGAGAAVF-------SATDEG 173

Query: 181 GILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIE 232
           GIL+T L +DGS  D LY   G    P++ +TV      ++MEG  VFK+AV+   +   
Sbjct: 174 GILATDLGADGSGADALYQTAGGSRKPASEQTVANREHYLKMEGTPVFKFAVKTMGKASL 233

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           KV     +  E++D  VPHQAN RII +   ++K+  ++V V +  +GNTSAAS+P+AL 
Sbjct: 234 KVLKKAGIKKEDVDLLVPHQANTRIIAAAAKRLKLKDEQVYVNLPEYGNTSAASVPIALT 293

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            A ++G +KKGD ++L A G G T  + +L W
Sbjct: 294 EAKEKGLLKKGDKIVLVAFGAGLTWASAVLEW 325


>gi|124265829|ref|YP_001019833.1| 3-oxoacyl-(acyl carrier protein) synthase III [Methylibium
           petroleiphilum PM1]
 gi|124258604|gb|ABM93598.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Methylibium
           petroleiphilum PM1]
          Length = 332

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 209/324 (64%), Gaps = 14/324 (4%)

Query: 6   VRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           + G G  LP R L+N+ L     +S V+TSD WI  R GI  RH A  D   + L   AA
Sbjct: 14  ITGTGSYLPPRRLTNAQLAAELAQSGVETSDEWIVERTGIRARHFAATDVACSDLAVEAA 73

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A     +IDLIIVATSTPD  FPSTA  +Q++LG+    AFD+QAVCSGFVYA+
Sbjct: 74  RHALEAAGRQAAEIDLIIVATSTPDMVFPSTACIVQHKLGVAGCPAFDLQAVCSGFVYAL 133

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD+ IR+G   R +VIG++ FSRI+D+ DR+TCVLFGDGAGA++LE  +         
Sbjct: 134 SVADAMIRTGAASRALVIGAEVFSRILDFKDRTTCVLFGDGAGAVVLEASDTP------- 186

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL+T L +DGS++  L V G  +     G   ++M+G+AVFK AV    E    V    
Sbjct: 187 GILATELHADGSHVGILCVPGTVAGGHVTGDPLLKMDGQAVFKLAVRVLDEAARAVLAKA 246

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
                ++DW +PHQAN RI+     K+K+P +K++VTVD HGNTSAAS+PLAL  AV+ G
Sbjct: 247 GRQEADVDWLIPHQANIRIMQGTAKKLKLPLEKLVVTVDEHGNTSAASVPLALDHAVRSG 306

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLL 322
           RVK GD ++LE +GGGFT G VLL
Sbjct: 307 RVKPGDTVMLEGVGGGFTWGAVLL 330


>gi|307257454|ref|ZP_07539221.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306864034|gb|EFM95950.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 316

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 212/324 (65%), Gaps = 13/324 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP ++ +N+DLE +VDT+D WI  R G+  R IA  DET A++G  AA+ A
Sbjct: 3   SKILATGSYLPAQIRTNADLEEMVDTTDEWIFTRSGMKERRIAAADETVATMGAQAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A++  ++IDLI+V T+T    +PS A  IQ  L ++   AFD+ A C+GFVYA++ A
Sbjct: 63  LEMAKIDHNEIDLIVVGTTTNSHAYPSAACQIQGMLDIQDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IRSG +++ +VIGSD  SR +D +DRST VLFGDGAGA++LE  E       + GI+
Sbjct: 123 DQFIRSGKIKKALVIGSDLNSRALDETDRSTVVLFGDGAGAVVLEANE-------EQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSR---TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ST+L S     D  Y+   P+  R     G I+M+G A FK AV +   ++E+  ++  L
Sbjct: 176 STHLHSSS---DSEYMLALPAQKRGDEKSGFIQMQGNATFKLAVGQLSSVVEETLEANSL 232

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
              ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+
Sbjct: 233 QKSDLDWLVPHQANIRIIAATAKKLEMDMSQVVLTVEKYGNNSAATVPVALDEAVRDGRI 292

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           ++G  LLLEA GGG+T G+ L+R+
Sbjct: 293 QRGQLLLLEAFGGGWTWGSALVRF 316


>gi|167855647|ref|ZP_02478405.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Haemophilus parasuis
           29755]
 gi|167853219|gb|EDS24475.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Haemophilus parasuis
           29755]
          Length = 316

 Score =  282 bits (721), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 138/321 (42%), Positives = 211/321 (65%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  +P +V +N+DLE +V+TSD WI  R GI  R IA  DET A++G  AA+  
Sbjct: 3   SKILATGSYMPTQVRTNADLEKMVETSDEWIVTRSGIKERRIAAADETVATMGFEAAKKC 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A + + +I+LI+V T++    +PS A  IQ  LG++   AFD+ A C+GFVYA++ A
Sbjct: 63  LEQANIDLQEINLIVVGTTSNSHAYPSAACQIQGLLGIEDAIAFDVAAACTGFVYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D ++R+G V++ +VIGSD  SR +D +DRST +LFGDGAGA+ILE       +  + GI+
Sbjct: 123 DQFVRTGQVKKALVIGSDLNSRNLDETDRSTVILFGDGAGAVILE-------ASTEQGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L +     + L +       +  G I M+G   FK AV++  +++E+   + +L   
Sbjct: 176 STHLHASPEKNEMLVLPYAQRGDKQSGYIEMQGNETFKLAVKQLSDVVEETLTANNLEKA 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+++  ++V++T+D +GNTSAA+IP+AL  AV++GR+K+G
Sbjct: 236 QLDWLVPHQANLRIISATAKKLEMDMEQVVITLDRYGNTSAATIPVALDEAVRDGRIKRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSALVRF 316


>gi|225874598|ref|YP_002756057.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidobacterium
           capsulatum ATCC 51196]
 gi|225794292|gb|ACO34382.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Acidobacterium
           capsulatum ATCC 51196]
          Length = 340

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 213/330 (64%), Gaps = 13/330 (3%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+ +  +G  +P RVL+N+DLE +VDT+D WI  RVGI  RHI  K + T+ +   AAR 
Sbjct: 14  RAKISSLGTYVPPRVLTNADLEKMVDTTDEWITTRVGIRERHILEKGKGTSDMAVEAARI 73

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
            L    ++  D+++IIVAT TPD  FP+TA  +Q++LG K  + FD+ A CSGFVYA+  
Sbjct: 74  CLEKRGLAATDVEVIIVATVTPDMLFPATACLVQDKLGAKGAWGFDLSAACSGFVYALQM 133

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
               + SG   RV+VIG+DT S I+D++DR+TCVLFGDGAGA+++E  E       +TG+
Sbjct: 134 GCKLVESGAHSRVLVIGADTMSSILDYTDRTTCVLFGDGAGAVLIEPAE-----EGETGM 188

Query: 183 LSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKV 234
           +      DGS    LY+  G    P T  T+      +  +G+AV+K+AV K  E   +V
Sbjct: 189 IDFVHEIDGSGGCSLYMPAGGSLNPPTHETIDKRMHYVHQDGQAVYKFAVRKMTEATTRV 248

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
            +   +T  ++  F+PHQAN RII++  +++ +P +KV++ +D +GNT+AA+IPLA+  A
Sbjct: 249 LERNGITGADLGCFIPHQANRRIIDASAERLGLPAEKVVINIDRYGNTTAATIPLAMGTA 308

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++EGR+KK D +L+ ++G GFT G  LLRW
Sbjct: 309 LEEGRLKKNDLILIASVGAGFTVGAALLRW 338


>gi|171912977|ref|ZP_02928447.1| 3-oxoacyl-(acyl carrier protein) synthase III [Verrucomicrobium
           spinosum DSM 4136]
          Length = 332

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 209/330 (63%), Gaps = 11/330 (3%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           + ++ G G  +P RVL+N DLE +V+TSD WI  R GI  R IA  DETT+ +   AAR 
Sbjct: 6   QCSIIGTGSYMPARVLTNHDLEKLVETSDEWITTRTGIKERRIAAPDETTSDMASEAARR 65

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           ALH A +  +++DLIIVAT TPD  FPSTA  +Q ++G      FD+ A CSGF+YA+ T
Sbjct: 66  ALHTAGVKPEEVDLIIVATVTPDMFFPSTACFVQKKIGATNAVGFDISAACSGFLYALQT 125

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A  ++  G  +  +VIG++  S +++W+DR+TCVLFGDGAGA +   +     + A   +
Sbjct: 126 ARHFLNGGPRKTALVIGAEKLSSLINWTDRNTCVLFGDGAGAAV---IRWDDQANAPGRV 182

Query: 183 LSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKV 234
           +S+++ +DG+  D L V GG    P T+  V      I MEG+  FK+AV +  +  EK 
Sbjct: 183 ISSFMGTDGNLADLLKVPGGGTALPITAENVHLRPNTIHMEGRETFKHAVTRMCQASEKA 242

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                LT +++   +PHQAN RII++I +++ +P ++  + +D +GNTSAA+IP+ L  A
Sbjct: 243 LKEAGLTAQDVKLVIPHQANARIISAIAERLGVPEERTFINLDKYGNTSAATIPVCLDEA 302

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            + GR+++GD LLL A GGGFT  + ++RW
Sbjct: 303 NRSGRIQRGDILLLVAFGGGFTWASTVIRW 332


>gi|300691986|ref|YP_003752981.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (beta-ketoacyl-ACP
           synthase III) (KAS III) [Ralstonia solanacearum PSI07]
 gi|299079046|emb|CBJ51708.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III) (KAS III) [Ralstonia solanacearum PSI07]
          Length = 326

 Score =  282 bits (721), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 210/325 (64%), Gaps = 15/325 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP + ++N +L     E  ++TSD WI  R GI  RH A  D T + L   AA  
Sbjct: 9   GTGSYLPPKRVTNDELAAQLAEKGIETSDEWIVTRSGIRARHYAEPDVTCSDLAVKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   +ID+I+VATSTPD  FPS A  +Q +LG+     AFD+QAVCSGFVYA+ 
Sbjct: 69  AIEAAGIDRAEIDMILVATSTPDFVFPSAACLVQQKLGLSNHCAAFDVQAVCSGFVYALA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IR+G  R V+VIG++ FSRI+D++DR+TCVLFGDGAGA++L+  +       + G
Sbjct: 129 TADKFIRAGGYRNVLVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS+ D L V G  +     G   + M+G+AVFK AV    ++  +      
Sbjct: 182 ILSTALHADGSHADILCVPGNVAAGAIQGSAFLYMDGQAVFKLAVNVLDKVAREALALAK 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    +DW +PHQAN RI+     K+ +P ++++VTVD HGNTSAASIPLAL  AV++GR
Sbjct: 242 VEASQVDWLIPHQANIRIMQGTAKKLGLPSERMVVTVDEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++KG  +LLE +GGGFT G  LLR+
Sbjct: 302 IRKGHHVLLEGVGGGFTWGAALLRF 326


>gi|209695675|ref|YP_002263604.1| 3-oxoacyl-(acyl carrier protein) synthase III [Aliivibrio
           salmonicida LFI1238]
 gi|208009627|emb|CAQ79923.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Aliivibrio
           salmonicida LFI1238]
          Length = 317

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 212/327 (64%), Gaps = 14/327 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +VDTSD WI  R GIS R IAG+ E+ A++G  A+ 
Sbjct: 1   MYSKILGTGSYLPAQVRTNADLEKMVDTSDEWILARTGISERRIAGEGESVATMGHLASV 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A +  +DIDLII+ATSTP  +FPS+A  +Q  L ++   AFD+ A CSGFVYA++
Sbjct: 61  KAIEMAGIDKNDIDLIILATSTPTYSFPSSACEVQGLLEIQGCPAFDLSAACSGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +I++G+ + V+VIGSD  S   D +DRST +LFGDGAGA+++   E       + G
Sbjct: 121 VADQHIKTGMAKNVLVIGSDAVSHTCDPTDRSTVILFGDGAGAVVVGQSE-------EPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           I+ST+L +DG + + L +   P  SR        + M G  VFK AV +   L+++    
Sbjct: 174 IISTHLHADGKFGELLSL---PVPSRRNEEADKWLYMAGNEVFKVAVTQLSNLVKETLHK 230

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
             +    +DW VPHQAN RII +   K+ +  D+V+VT+D HGNTSAA++P AL  AV++
Sbjct: 231 NQMDKSELDWLVPHQANLRIIKATAKKLSMSMDQVVVTLDRHGNTSAATVPTALDEAVRD 290

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+K+G  LLLEA GGGFT G+ L+++
Sbjct: 291 GRIKRGQTLLLEAFGGGFTWGSALVKF 317


>gi|257465222|ref|ZP_05629593.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus minor
           202]
 gi|257450882|gb|EEV24925.1| 3-oxoacyl-(acyl carrier protein) synthase III [Actinobacillus minor
           202]
          Length = 316

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 209/323 (64%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S +   G  +P +V +N+DLE +V+TSD WI  R G+  R IA  DET A++G  AA+
Sbjct: 1   MNSKILATGSYMPAQVRTNADLEKMVETSDEWIVTRSGMKERRIAAADETVATMGFEAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
             L    +   +IDLI+V T++    +PS A  IQ  LG++   +FD+ A C+GFVYA++
Sbjct: 61  KCLEQVNLDPQEIDLIVVGTTSNSHAYPSAACQIQGMLGIEDAISFDVAAACTGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD ++R+G +++ +V+GSD  SR +D +DR T VLFGDGAGA+ILE  E       + G
Sbjct: 121 VADQFVRTGKIKKALVVGSDLNSRKLDETDRGTVVLFGDGAGAVILEASE-------EQG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L +     + L +      +   G I M+G A FK AV++  +++E+   +  L 
Sbjct: 174 IISTHLHASADTKEALVLPNVERGNDRSGFISMQGNATFKLAVKQLSDVVEETLAANQLD 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN RII++  +K+ +  D+V+VTVD +GNTSAA+IP+AL  AV++GR+K
Sbjct: 234 KSELDWLVPHQANLRIISATAEKLDMSMDQVVVTVDRYGNTSAATIPVALDEAVRDGRIK 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGG+T G+ L+R+
Sbjct: 294 RGQLLLLEAFGGGWTWGSALVRF 316


>gi|123441939|ref|YP_001005922.1| 3-oxoacyl-(acyl carrier protein) synthase III [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|166233407|sp|A1JN67|FABH_YERE8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|122088900|emb|CAL11707.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 321

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 210/334 (62%), Gaps = 24/334 (7%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP +V SN+DLE +VDTSD WI  R GI  R IAG DET AS+G  AA+
Sbjct: 1   MYTKILGTGSYLPVQVRSNADLEKMVDTSDEWIVTRTGIRERRIAGPDETVASMGFQAAK 60

Query: 62  DALHHAEMSV-------DDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCS 114
            AL   EM+V        DI LIIVAT++    FPS+A  +Q  LG++   +FD+ A C+
Sbjct: 61  KAL---EMAVIDEGIDKKDIGLIIVATTSSSHAFPSSACQVQQMLGIEDAASFDLAAACA 117

Query: 115 GFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKG 174
           GF YA++ AD Y++SG V+  +VIGSD  SR +D  DR T +LFGDGAGA++L   E   
Sbjct: 118 GFTYALSVADQYVKSGAVKHAIVIGSDMLSRALDPEDRGTIILFGDGAGAVVLGASE--- 174

Query: 175 SSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRT----VGCIRMEGKAVFKYAVEKAVEL 230
               + GILST+L +DG Y + L +   P   R        + M G  VFK AV +   +
Sbjct: 175 ----EPGILSTHLHADGKYGELLAL---PYPDRQHQEQPAYVTMAGNEVFKVAVTELAHI 227

Query: 231 IEKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLA 290
           +++   + +L    +DW VPHQAN RII++   K+ +  DKV++T+D HGNTSAAS+P A
Sbjct: 228 VDETLQANNLDRSALDWLVPHQANLRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAA 287

Query: 291 LAVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
              AV++GR+++G  +LLEA GGGFT G+ L+R+
Sbjct: 288 FDEAVRDGRIQRGQLVLLEAFGGGFTWGSALVRF 321


>gi|237747696|ref|ZP_04578176.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Oxalobacter
           formigenes OXCC13]
 gi|229379058|gb|EEO29149.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Oxalobacter
           formigenes OXCC13]
          Length = 328

 Score =  281 bits (720), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 220/332 (66%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           I + + G G  LP + ++N +L +I     V+TSD WI+ R GI  RH A +   ++ LG
Sbjct: 3   IYAKIIGTGSYLPPKRITNDELAAILAKQGVETSDEWIRTRSGILARHYADEGVQSSDLG 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPD--QTFPSTAVNIQNRLGMKRGFA-FDMQAVC 113
             AA  AL  A+   +DID+II+ATSTPD    FPSTA  +Q +LG+    A FD+QAVC
Sbjct: 63  VKAAEKALEMAKCQANDIDMIILATSTPDFFGGFPSTACMVQKKLGVTSNCAAFDVQAVC 122

Query: 114 SGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVK 173
           SGF+YA++ ADS+IR+GV ++V+V+G++T+SRIVD++DR+TCVLFGDGAGA++L      
Sbjct: 123 SGFLYALSVADSFIRAGVYKKVLVVGAETYSRIVDYNDRTTCVLFGDGAGAVVL------ 176

Query: 174 GSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELI 231
            S+  + GI++T L +DG+Y D L + G  S     G   + M+GKAVFK AV    ++ 
Sbjct: 177 -SASDEPGIMATALHADGNYGDILSLPGKLSNGVVEGKAFVYMDGKAVFKLAVTWMDKVG 235

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
            +      L   +IDW +PHQAN RI+ S   K+ IP +K+IVTVD HGNTSAASIPLA+
Sbjct: 236 LEAMGKAGLKNTDIDWMIPHQANLRIMQSSARKLDIPDEKIIVTVDQHGNTSAASIPLAI 295

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
              V++GR+K G  +LL A+GGG T G V+ +
Sbjct: 296 DTGVRDGRIKPGQNILLAAIGGGLTWGAVVAK 327


>gi|94676843|ref|YP_588877.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|166233358|sp|Q1LT37|FABH_BAUCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|94219993|gb|ABF14152.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 317

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 204/324 (62%), Gaps = 8/324 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP ++ SN+DL ++VDTSD WI  R GI  R IA  +ET  S+G +AA 
Sbjct: 1   MYTKILGTGSYLPTQIRSNTDLANMVDTSDEWIIARTGIRERRIASANETVFSMGSSAAE 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            ALH A +S + + +IIVAT++    FPS+A  IQ  LG+    AFD+ A C+GF YA++
Sbjct: 61  QALHMAGISANKVGMIIVATTSSSHAFPSSACQIQRDLGIMDCVAFDLAAACAGFPYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
             D YI++GV+   +VIGSD  S      DRST +LFGDGAGA+++   E         G
Sbjct: 121 IVDQYIKNGVIEYALVIGSDVLSNTPAPDDRSTLILFGDGAGAVLVGCSE-------QPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-IRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           ILST+L +DGSY D L +      + T    ++M G  VFK AV K   L+++     HL
Sbjct: 174 ILSTHLHADGSYSDLLTLPYYNRFNPTADIYLKMSGNEVFKIAVTKLAHLVDETMSINHL 233

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           + + IDW VPHQAN RII++    + +  +KVIVT+D HGNTSAASIPLAL  AV++GR+
Sbjct: 234 SSKEIDWLVPHQANLRIISATAKLLGMKMNKVIVTLDKHGNTSAASIPLALDEAVRDGRI 293

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           K    LLLEA GGG T G+ LLR+
Sbjct: 294 KTDQLLLLEAFGGGLTWGSALLRF 317


>gi|167041967|gb|ABZ06704.1| putative chalcone and stilbene synthase, C-terminal domain protein
           [uncultured marine microorganism HF4000_141E02]
          Length = 321

 Score =  281 bits (719), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 145/320 (45%), Positives = 202/320 (63%), Gaps = 16/320 (5%)

Query: 10  GLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEM 69
           G  LP  +++N DLE  VDT+D WI+ R GI +R IA  D+ T+ L   AA  A++ AE+
Sbjct: 9   GSYLPENIVTNRDLEQQVDTTDEWIRTRTGIEQRRIASIDQNTSDLAYEAANRAINKAEI 68

Query: 70  SVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRS 129
           + + IDLIIV T TPD   P+    IQ RLG+K   AF ++A CSGF+YA+  AD +IRS
Sbjct: 69  AAESIDLIIVGTCTPDVVTPNVGTIIQERLGIKNSAAFSVEAACSGFIYAMNIADKFIRS 128

Query: 130 GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCS 189
                 +V+G+DT SRI DW+DR+TCVLF DGAGA IL+  +         GIL + L +
Sbjct: 129 RDASCALVVGADTLSRITDWTDRNTCVLFADGAGAAILQPSDTP-------GILFSELGA 181

Query: 190 DGSYIDKLYVDGGPSTSRTVG-------CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           +G+Y D LYV  G  TSR          C+ M+G  VFK AV+    +  +     ++ +
Sbjct: 182 NGAYGDLLYVPYG--TSRKPEQPKPDDYCLHMKGNEVFKVAVKTLESITLEALAKQNMNV 239

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
            +IDWF+PHQAN RII+S+  ++ IP +KVI+T+  HGNTSAASIPLAL   +  G+++ 
Sbjct: 240 NDIDWFIPHQANTRIIHSVAKRLGIPIEKVIITLSHHGNTSAASIPLALDEGIDSGKIES 299

Query: 303 GDCLLLEAMGGGFTSGTVLL 322
           GD +L+   G GFT GT+++
Sbjct: 300 GDTILMLGFGAGFTWGTMII 319


>gi|170700228|ref|ZP_02891244.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria IOP40-10]
 gi|170134861|gb|EDT03173.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria IOP40-10]
          Length = 329

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 217/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A +D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAQDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AAR A+  A +    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEAARRAIEAANIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLYMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 TAVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|54297303|ref|YP_123672.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Legionella
           pneumophila str. Paris]
 gi|53751088|emb|CAH12499.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Legionella
           pneumophila str. Paris]
          Length = 317

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 146/326 (44%), Positives = 210/326 (64%), Gaps = 11/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G   P R ++N++LE+++DTSD WI  R GIS R +A + ETT+ +   AA
Sbjct: 1   MKNAVINGTGSYSPERQMTNAELETMLDTSDEWIVTRTGISSRSVAQEHETTSYMASRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
             AL  + +  ++IDLI+VAT TPD  FPS A ++Q+ LG+KR   AFD+ A CSGFVYA
Sbjct: 61  EQALEASGLDAEEIDLILVATCTPDYFFPSVACHVQHALGIKRPIPAFDIGAACSGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +  A  YI +G  + V+V+GS++ SR VDW+DRS CVLFGDGAGA++L   + +G     
Sbjct: 121 MDVAKQYIATGAAKHVLVVGSESMSRAVDWTDRSICVLFGDGAGAVVLSASDRQG----- 175

Query: 180 TGILSTYLCSDGSY-IDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
             I+ + L S  +Y  DKL V    +  +    I M G  VFK AV     ++++V +++
Sbjct: 176 --IMGSVLHS--AYDSDKLLVLRNSTFEQDRATIGMRGNEVFKIAVNIMGNIVDEVLEAS 231

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           HL   +IDW +PHQAN RII +I  K+ +P   VIVT+   GNTSAASIPLAL  ++K  
Sbjct: 232 HLKKSDIDWLIPHQANIRIIQAIAKKLSLPMSHVIVTIGNQGNTSAASIPLALDYSIKNN 291

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+ + LL+E+ GGG T G +++R+
Sbjct: 292 RIKRDEILLIESFGGGMTWGAMVIRY 317


>gi|332799141|ref|YP_004460640.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Tepidanaerobacter sp.
           Re1]
 gi|332696876|gb|AEE91333.1| 3-oxoacyl-(acyl-carrier-protein) synthase 3 [Tepidanaerobacter sp.
           Re1]
          Length = 326

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/331 (43%), Positives = 217/331 (65%), Gaps = 15/331 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           +R+ + GIG  +P +V+SN DLE IVDTS+ WI  R GI  R  A  +  ++ LG  AA+
Sbjct: 1   MRAGIIGIGSYVPDKVISNFDLEKIVDTSNEWIVERTGIYNRRKADYNICSSDLGAEAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+ +A++  +DIDLII A+S+PD+ FP+TA  IQ ++G K   A D+QA CSGF+YA+T
Sbjct: 61  YAIKNADLKPEDIDLIISASSSPDRIFPATACIIQKKIGAKNAAALDIQAACSGFIYALT 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TA  YI +G  + V+V+GS+  S++ DW DR+TCVLFGDGAGA++L  VE       D G
Sbjct: 121 TATQYIMAGQYKNVLVVGSEVLSKLTDWEDRNTCVLFGDGAGAVVLSEVE-------DGG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGG----PSTSRTV----GCIRMEGKAVFKYAVEKAVELIEK 233
           +L++ L +DG   + L +  G    P++  T+      I+MEG  VFK+AV    +  +K
Sbjct: 174 VLASILGADGDGSELLELPAGGTKEPASFDTIENRRHYIKMEGNEVFKFAVRIFEDCTKK 233

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V + ++L++E+ID  VPHQAN RII + + ++K P ++V++ +D +GN S+ASIP+AL  
Sbjct: 234 VIEKSNLSLEDIDCIVPHQANIRIIEAAIKRLKFPRERVVINLDKYGNMSSASIPVALDE 293

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           A + G++KKG  ++L   G G T G  L+ W
Sbjct: 294 AFRTGKIKKGHKIVLVGFGAGLTWGANLIDW 324


>gi|157146211|ref|YP_001453530.1| 3-oxoacyl-(acyl carrier protein) synthase III [Citrobacter koseri
           ATCC BAA-895]
 gi|166233368|sp|A8AHY1|FABH_CITK8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157083416|gb|ABV13094.1| hypothetical protein CKO_01967 [Citrobacter koseri ATCC BAA-895]
          Length = 317

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +V+TSD WI  R GI  RHIA  +ET A++G  AA  AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAAPNETVATMGYTAANRALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +VIGSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVIGSDVLARTCDPTDRGTIIIFGDGAGAAVLSASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENPIYLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKAG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|34498871|ref|NP_903086.1| 3-oxoacyl-(acyl carrier protein) synthase III [Chromobacterium
           violaceum ATCC 12472]
 gi|46576427|sp|Q7NSK7|FABH_CHRVO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|34104723|gb|AAQ61080.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Chromobacterium
           violaceum ATCC 12472]
          Length = 319

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 210/326 (64%), Gaps = 9/326 (2%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  S + G G  LP +VL+N+ L   V+TSD WI  R GI  RHIA +   T+ L   AA
Sbjct: 1   MGYSRILGTGSFLPSQVLTNAQLAERVETSDEWIVSRTGIRARHIADEGHKTSDLALRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           + A+  A +   +IDLIIVAT+TPD  FPSTA  +Q +LG+    AFD+QAVC+GFVYA+
Sbjct: 61  QAAIASAGIDKGEIDLIIVATTTPDMVFPSTACILQEKLGLPGVQAFDVQAVCAGFVYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTA++YI+SG+ ++ +V+G++  SR++DW DR TCVLFGDGAGA++L      G S  + 
Sbjct: 121 TTANAYIKSGLAKKALVVGAEIMSRVLDWDDRRTCVLFGDGAGAVVL------GES-DEP 173

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDST 238
           GIL   L +DG Y   L      S  +  G   + M+G AVFK+AV+   E+        
Sbjct: 174 GILHAKLAADGRYQGLLNTPAQISGGKIQGIPYLHMDGPAVFKFAVKSLSEIATATLAEA 233

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +   ++DW VPHQAN RII S    + +P DKV+VT+   GNTSAASIPLAL VAV++G
Sbjct: 234 GVEQASLDWLVPHQANLRIIESTAKHLGLPMDKVVVTLPEQGNTSAASIPLALDVAVRDG 293

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+++G  ++LE +GGGF  G VLL +
Sbjct: 294 RIRRGQTVMLEGIGGGFAWGAVLLTF 319


>gi|146296615|ref|YP_001180386.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|189037886|sp|A4XJW0|FABH_CALS8 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|145410191|gb|ABP67195.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 328

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 153/328 (46%), Positives = 202/328 (61%), Gaps = 24/328 (7%)

Query: 10  GLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEM 69
           G  +P RVL+N DLE +VDTSD WI +R GI  R I     +T  L   AA++A+  A +
Sbjct: 11  GRYVPDRVLTNYDLEKMVDTSDEWITQRTGIKERRIVDGTTSTTDLAVRAAKNAMDKAGI 70

Query: 70  SVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRS 129
             DDIDL+IVAT TP+  FPSTA  +Q  L +K  FAFD+ A CSGF+YA+  A  +I++
Sbjct: 71  LPDDIDLVIVATVTPEMFFPSTACLVQKELKLKNAFAFDISAACSGFIYAMAIATHFIQN 130

Query: 130 GVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCS 189
           G  +  +VIG++  SRI +WSDRSTCVLFGDGAGA IL       SS  + GIL   L S
Sbjct: 131 GFCKNALVIGAEALSRITNWSDRSTCVLFGDGAGAAIL-------SSSDEQGILGFELGS 183

Query: 190 DGSYIDKLY-------------VDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           DG     LY             V   P+  +    I MEG  V+K+AV+     +EKV +
Sbjct: 184 DGENGLLLYCHAFGLSDVTYSQVKENPNFRK----IYMEGNEVYKFAVKIMPYAVEKVLE 239

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L+  +ID F+PHQAN RII S   ++KIP +KV V +  +GNTSAASIP+AL  AV+
Sbjct: 240 KVGLSSSDIDVFIPHQANIRIIESAAKRLKIPMEKVFVNLHKYGNTSAASIPIALDEAVE 299

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           EGR+KKGD ++L   GGG T  + +++W
Sbjct: 300 EGRIKKGDKVVLVGFGGGLTWASTVIKW 327


>gi|237731023|ref|ZP_04561504.1| beta-ketoacyl-ACP synthase III [Citrobacter sp. 30_2]
 gi|226906562|gb|EEH92480.1| beta-ketoacyl-ACP synthase III [Citrobacter sp. 30_2]
          Length = 317

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 206/321 (64%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +V+TSD WI  R GI  RHIA  +ET A++G AAA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAAPNETVATMGFAAANRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  + I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKEQIGLIVVATTSSTHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA++L   E       + GILST+L
Sbjct: 127 KSGAVKHALVVGSDVLARTCDPTDRGTIIIFGDGAGAVVLSASE-------EPGILSTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P+  R        + M G  VFK AV +   ++++  ++ +L   
Sbjct: 180 HADGRYGELLTL---PNADRVNPENPIHLTMAGNEVFKVAVTELAHIVDETLEANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ALDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKAG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLILLEAFGGGFTWGSALVRF 317


>gi|114562673|ref|YP_750186.1| 3-oxoacyl-(acyl carrier protein) synthase III [Shewanella
           frigidimarina NCIMB 400]
 gi|114333966|gb|ABI71348.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Shewanella
           frigidimarina NCIMB 400]
          Length = 319

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 211/327 (64%), Gaps = 12/327 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP +V SN DLE +V+TSD WI  R GIS R IA  DE+ +++G  AA 
Sbjct: 1   MHTKILGTGSYLPVQVRSNQDLEKMVETSDQWIVDRTGISERRIAASDESVSTMGYQAAL 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            AL  A +   D+D+I+  T++    FP+ A  IQ  LG+K   AFD+ A CSGF+YA++
Sbjct: 61  KALEMAGIEASDLDMIVCGTTSASNAFPAAACEIQALLGVKNIPAFDIAAACSGFIYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT- 180
            AD ++++G  ++V+VIGSD  SR+ D +DRST +LFGDGAGA I+         ++DT 
Sbjct: 121 VADQFVKTGSAKKVLVIGSDVLSRMCDPADRSTVILFGDGAGAAII--------GVSDTP 172

Query: 181 GILSTYLCSDGSYIDKLYVDGGP---STSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDS 237
           GI++T++ +DGS  D L     P    +S  VG + M+G  VFK AV +   ++ +    
Sbjct: 173 GIIATHIYADGSQGDLLKCSFPPRANESSEAVGFMTMKGNDVFKVAVTQLSNVVTETLRL 232

Query: 238 THLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKE 297
            ++    IDW VPHQAN+RIIN+   K+ +  DKV++T+  HGNTSAAS+P+AL  AV++
Sbjct: 233 NNVDKSEIDWLVPHQANFRIINATAKKLHMSLDKVVLTLARHGNTSAASVPIALDEAVRD 292

Query: 298 GRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           GR+++G  LLLEA GGGF  G+ L+R+
Sbjct: 293 GRIQRGHLLLLEAFGGGFAWGSALVRF 319


>gi|218549182|ref|YP_002382973.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia
           fergusonii ATCC 35469]
 gi|218356723|emb|CAQ89351.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia
           fergusonii ATCC 35469]
 gi|324113886|gb|EGC07860.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia fergusonii
           B253]
 gi|325497603|gb|EGC95462.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia
           fergusonii ECD227]
          Length = 317

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 207/321 (64%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGYEAANRALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  ++I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKNEIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA++L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAVVLGASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++  ++ +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPDNPIHLTMAGNEVFKVAVTELAHIVDETLEANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMSMDHVVVTLDRHGNTSAASVPCALDEAVRDGRIKAG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALIRF 317


>gi|33151937|ref|NP_873290.1| 3-oxoacyl-(acyl carrier protein) synthase III [Haemophilus ducreyi
           35000HP]
 gi|46576436|sp|Q7U337|FABH_HAEDU RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|33148159|gb|AAP95679.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Haemophilus ducreyi
           35000HP]
          Length = 316

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 208/321 (64%), Gaps = 7/321 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           S +   G  LP++V SN+DLE +VDT+D WI  R G+  R IA  DET A++G AAA  A
Sbjct: 3   SKILATGSYLPKQVRSNADLEKMVDTTDEWIFTRSGMKERRIAAADETVATMGAAAAHKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
              A + V++I+LI+VAT+T    +PS A  IQ  L ++   AFD+ A C+GF+YA++ A
Sbjct: 63  CEMAAIDVNEIELIVVATTTHSHAYPSAACQIQGMLAIEDAIAFDVAAACTGFIYALSVA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +IR+G V+   V+G+D  SR++D +DR T VLFGDGAGA+IL+  E         GIL
Sbjct: 123 DQFIRAGKVKTAFVVGADVNSRVLDEADRGTVVLFGDGAGAVILQASE-------QAGIL 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           ST+L S     + L +      +   G I+M+G A FK AV +   ++E+   + +L   
Sbjct: 176 STHLHSSADTDNMLALPIQERGNAQSGFIQMQGNATFKLAVSRLANVVEETLQANNLQKA 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           ++DW VPHQAN RII +   K+++   +V++TV+ +GN SAA++P+AL  AV++GR+++G
Sbjct: 236 DLDWLVPHQANIRIIAATAKKLEMEMSQVVLTVEKYGNNSAATVPVALDEAVRDGRIQRG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             LLLEA GGG+T G+ L+R+
Sbjct: 296 QLLLLEAFGGGWTWGSGLVRF 316


>gi|315648186|ref|ZP_07901287.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus vortex
           V453]
 gi|315276832|gb|EFU40175.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus vortex
           V453]
          Length = 329

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 208/326 (63%), Gaps = 16/326 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  +P ++LSN DLE +VDTSD WI    GI  RHIA  +E T+ L   AA +AL  A
Sbjct: 11  GTGKYVPEKILSNRDLEKMVDTSDEWIVSMTGIRERHIAAPNEATSDLAYHAAVNALKSA 70

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            M  +D++LIIVAT TPD  FPSTA  +Q+RLG K+  AFD+ A CSGFVY + TA +++
Sbjct: 71  GMQAEDLELIIVATITPDMFFPSTACLLQDRLGAKKAAAFDLSAACSGFVYGLATATNFV 130

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALIL-EGVEVKGSSMADTGILSTY 186
           ++G+    +VIG D  SRI D++DR+TCVLFGDGAGA I+ E  E +G    D G     
Sbjct: 131 KTGMYNNALVIGVDCLSRITDYTDRNTCVLFGDGAGAAIVGEVPEGRGFQAFDLG----- 185

Query: 187 LCSDGSYIDKLYVDGG----PSTSRTVGC----IRMEGKAVFKYAVEKAVELIEKVFDST 238
             ++G+    LY++ G    P+++ T+      I M G+ VFK+AV       E V    
Sbjct: 186 --AEGAGGAHLYIEAGGSRLPASAETINTNKHYIYMNGREVFKFAVRVMGSATEAVLSKA 243

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +  ++ID FVPHQAN RII S ++++++P +KV++ VD + NTSAAS+PLAL  A + G
Sbjct: 244 GIDKKDIDLFVPHQANIRIIKSAMERLELPEEKVVINVDKYANTSAASVPLALVEAQESG 303

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+GD +L+   GGG T G+ +L W
Sbjct: 304 RLKEGDKVLMVGFGGGLTWGSSVLIW 329


>gi|269926750|ref|YP_003323373.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermobaculum
           terrenum ATCC BAA-798]
 gi|269790410|gb|ACZ42551.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermobaculum
           terrenum ATCC BAA-798]
          Length = 344

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 204/330 (61%), Gaps = 14/330 (4%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
            + + G G  +P +VL+N DLE +VDTSD WI+ R GI  R IA  D+TT+S+G  AA+ 
Sbjct: 4   HAAITGWGFCVPEKVLTNYDLEKMVDTSDEWIRTRTGIVERRIASSDQTTSSMGVIAAQR 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A ++  D+DLI+ AT TPD   P+TA  IQ+ LG     A D+ A CSGFVYA+ T
Sbjct: 64  ALDKAHLAAIDLDLILCATCTPDHLIPATACLIQHELGAVNAAALDINAACSGFVYALVT 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A  +I SG   RV+++ ++T SR V+W DR+TC+LFGDGAGA++LE  +       D G+
Sbjct: 124 ASQFIMSGTYDRVLIVAAETLSRFVNWQDRNTCILFGDGAGAVLLEATD------QDGGL 177

Query: 183 LSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKV 234
           +S+ L + G     L ++GG    P+   T+     CIRM+G  VFK+AV    +  ++ 
Sbjct: 178 VSSVLGAQGDVGRLLTIEGGGSAKPANPDTLANGEHCIRMKGNEVFKFAVRSMGQTAKQA 237

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
            D   L  E+I   +PHQAN RII +  + + IP++KV V VD +GNTSAAS+P+AL   
Sbjct: 238 IDKAGLKPEDIRKVIPHQANIRIIKATQEALGIPWEKVFVNVDRYGNTSAASVPIALCEF 297

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++   V  GD LL  A GGG T G  ++RW
Sbjct: 298 LETEEVSPGDNLLFVAFGGGLTWGAAVVRW 327


>gi|115351051|ref|YP_772890.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           ambifaria AMMD]
 gi|172060056|ref|YP_001807708.1| 3-oxoacyl-(acyl carrier protein) synthase III [Burkholderia
           ambifaria MC40-6]
 gi|115281039|gb|ABI86556.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Burkholderia
           ambifaria AMMD]
 gi|171992573|gb|ACB63492.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria MC40-6]
          Length = 329

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 217/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AAR A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG++ G  AFD+QAVCSG
Sbjct: 66  LEAARRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIRNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLYMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+K+G  +L+E +GGGFT G  + R+
Sbjct: 298 TAVRDGRIKRGQHVLIEGVGGGFTWGASVFRF 329


>gi|161503721|ref|YP_001570833.1| 3-oxoacyl-(acyl carrier protein) synthase III [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189037902|sp|A9MGC9|FABH_SALAR RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|160865068|gb|ABX21691.1| hypothetical protein SARI_01805 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 317

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +V+TSD WI  R GI  RHIA  +ET A++G  AA  AL  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVETSDEWIVTRTGIRERHIAAPNETVATMGFTAANRALEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSIADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D SDR T ++FGDGAGA++L   E       + GI+ST+L
Sbjct: 127 KSGAVKHALVVGSDVLARTCDPSDRGTIIIFGDGAGAVVLSASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DG Y + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGRYGELLTL---PNADRVNPDNPIYLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 ELDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKAG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALIRF 317


>gi|91202495|emb|CAJ72134.1| strongly similar to 3-oxoacyl[acyl-carrier protein] synthase III
           [Candidatus Kuenenia stuttgartiensis]
          Length = 336

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 212/329 (64%), Gaps = 14/329 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           +++ GIG  LP ++L+N  LE +VDT+D WI +R GI  R I     TT+ LG  A+  A
Sbjct: 14  TSITGIGSYLPEKILTNHALEKLVDTTDDWILQRTGIRERRIVENGVTTSDLGAIASLKA 73

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           + +A +S ++ID+II +T TPD  FPST+  +Q ++G     AFD+ A C+GFVYA++  
Sbjct: 74  IENAGISAEEIDMIITSTITPDYLFPSTSCCLQKQIGAVHASAFDISAACAGFVYALSIG 133

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
            S I SG  + V+V+G++  S+I D++DR+TC+LFGDGAGA+IL+  + K        IL
Sbjct: 134 QSVINSGAAKTVLVVGAECLSKITDYTDRATCILFGDGAGAVILQNNKEKHQ------IL 187

Query: 184 STYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVF 235
            T L SDG+Y D L + GG    P+T  +V      IR +G+ VFK A+     L+ +  
Sbjct: 188 DTRLVSDGTYTDVLIIPGGGSKHPATIESVQERLHYIRFKGREVFKLAINTITNLVIETA 247

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
                 +++ID  +PHQ+N RII + ++++K+P +K  V +D +GNTS+AS+P+A+  A 
Sbjct: 248 QRNGFAVQDIDLIIPHQSNLRIIEATMERLKLPMEKAFVNIDKYGNTSSASVPIAIDEAQ 307

Query: 296 KEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           +EGR+KKGD ++L A GGG T G+ ++RW
Sbjct: 308 QEGRLKKGDLVMLVAFGGGLTWGSCVVRW 336


>gi|254252856|ref|ZP_04946174.1| 3-oxoacyl-(acyl carrier protein) synthase [Burkholderia dolosa
           AUO158]
 gi|124895465|gb|EAY69345.1| 3-oxoacyl-(acyl carrier protein) synthase [Burkholderia dolosa
           AUO158]
          Length = 329

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 217/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A  D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKDGIETSDEWIVARTGIHARHFAAPDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AAR A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEAARRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   E   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASEEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLYMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 AAVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|219871722|ref|YP_002476097.1| 3-oxoacyl-(acyl carrier protein) synthase III [Haemophilus parasuis
           SH0165]
 gi|219691926|gb|ACL33149.1| 3-oxoacyl-(acyl carrier protein) synthase III [Haemophilus parasuis
           SH0165]
          Length = 305

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 136/312 (43%), Positives = 208/312 (66%), Gaps = 7/312 (2%)

Query: 13  LPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVD 72
           +P +V +N+DLE +V+TSD WI  R GI  R IA  DET A++G  AA+  L  A + + 
Sbjct: 1   MPTQVRTNADLEKMVETSDEWIVTRSGIKERRIAAADETVATMGFEAAKKCLEQANIDLQ 60

Query: 73  DIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVV 132
           +I+LI+V T++    +PS A  IQ  LG++   AFD+ A C+GFVYA++ AD ++R+G V
Sbjct: 61  EINLIVVGTTSNSHAYPSAACQIQGLLGIEDAIAFDVAAACTGFVYALSVADQFVRTGQV 120

Query: 133 RRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGS 192
           ++ +VIGSD  SR +D +DRST +LFGDGAGA+ILE       +  + GI+ST+L +   
Sbjct: 121 KKALVIGSDLNSRNLDETDRSTVILFGDGAGAVILE-------ASTEQGIISTHLHASPE 173

Query: 193 YIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQ 252
             + L +       +  G I M+G   FK AV++  +++E+   + +L    +DW VPHQ
Sbjct: 174 KNEMLVLPYAQRGDKQSGYIEMQGNETFKLAVKQLSDVVEETLTANNLEKAQLDWLVPHQ 233

Query: 253 ANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMG 312
           AN RII++   K+++  ++V++T+D +GNTSAA+IP+AL  AV++GR+K+G  LLLEA G
Sbjct: 234 ANLRIISATAKKLEMDMEQVVITLDRYGNTSAATIPVALDEAVRDGRIKRGQLLLLEAFG 293

Query: 313 GGFTSGTVLLRW 324
           GG+T G+ L+R+
Sbjct: 294 GGWTWGSALVRF 305


>gi|304413616|ref|ZP_07395060.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus Regiella
           insecticola LSR1]
 gi|304283707|gb|EFL92101.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Candidatus Regiella
           insecticola LSR1]
          Length = 335

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 213/333 (63%), Gaps = 13/333 (3%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + + + G G  LP  V SN+DLE +VDT++ WI  R GI  R IA   ET AS+G  AA+
Sbjct: 6   MNTKILGTGSYLPAEVRSNADLEKMVDTTNDWIVTRTGIKERRIAKAHETVASMGCHAAK 65

Query: 62  DALHHAE-------MSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCS 114
            AL  A+          +DI LIIVAT++    FPS+A  IQ  LG+K   +FD+ A CS
Sbjct: 66  KALEMAQKVREPKKFDENDIGLIIVATTSSSHAFPSSACQIQQMLGIKDAISFDLAAACS 125

Query: 115 GFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILE---GVE 171
           GF+YA++ +D +I+SG V+  +VIGSD  SR++D  DR T +LFGDGAGA++L    G +
Sbjct: 126 GFIYALSVSDKFIKSGTVKNALVIGSDALSRMLDEQDRGTVILFGDGAGAVVLSASTGSD 185

Query: 172 VKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELI 231
           +  +  +D  ILSTYL +DG   + L +    S  +    + M+G  VFK AV +  ++I
Sbjct: 186 IDRTLPSD--ILSTYLHADGRSGNLLALPHQHSQDQP-AYLTMKGCEVFKIAVNELAKII 242

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
           ++   +  +    +DW +PHQAN RII +  +K+K+  +KV++T+D HGNTSAAS+P AL
Sbjct: 243 DETLKANDICHSQLDWLIPHQANLRIIKATAEKLKMDMEKVVITLDQHGNTSAASVPSAL 302

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
             AV++GR+++G  LLLEA GGGFT G+ L+R+
Sbjct: 303 DAAVRDGRIQRGQLLLLEAFGGGFTWGSALIRF 335


>gi|17545769|ref|NP_519171.1| 3-oxoacyl-(acyl carrier protein) synthase III [Ralstonia
           solanacearum GMI1000]
 gi|34098628|sp|Q8Y0J4|FABH_RALSO RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|17428063|emb|CAD14752.1| probable 3-oxoacyl-[acyl-carrier-protein] synthase III
           (beta-ketoacyl-acp synthase III) (kas III) [Ralstonia
           solanacearum GMI1000]
          Length = 326

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 208/325 (64%), Gaps = 15/325 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP + ++N +L     E  ++TSD WI  R GI  RH A  D T + L   AA  
Sbjct: 9   GTGSYLPPKRVTNHELAAQLAEQGIETSDEWIVTRSGIRARHYAEPDVTCSDLAAKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   +IDLI+VATSTPD  FPS A  +Q +LG+     AFD+QAVCSGFVY + 
Sbjct: 69  AIEAAGIDRAEIDLILVATSTPDFVFPSAACLVQQKLGLSNHCAAFDLQAVCSGFVYGLA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IR+G  R  +VIG++ FSRI+D++DR+TCVLFGDGAGA++L+  +       + G
Sbjct: 129 TADKFIRAGGYRNALVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS+ D L V G  +     G   + M+G+AVFK AV    ++  +      
Sbjct: 182 ILSTALHADGSHADILCVPGNVAGGAIKGSAFLYMDGQAVFKLAVNVLDKVAREALALAE 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    IDW +PHQAN RI+     K+ +P ++++VTVD HGNTSAASIPLAL  AV++GR
Sbjct: 242 VESSQIDWLIPHQANIRIMQGTAKKLGLPGERMVVTVDEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++KG  +LLE +GGGFT G  LLR+
Sbjct: 302 IQKGHHVLLEGVGGGFTWGAALLRF 326


>gi|317121784|ref|YP_004101787.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermaerobacter
           marianensis DSM 12885]
 gi|315591764|gb|ADU51060.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermaerobacter
           marianensis DSM 12885]
          Length = 418

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 203/328 (61%), Gaps = 14/328 (4%)

Query: 5   TVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDAL 64
           T+ GIG  +P  V++N DL  +V+T D WI+ R GI +R +A     T+ L E AAR AL
Sbjct: 9   TIAGIGGCVPPAVVTNDDLAQVVETDDEWIRTRTGIRQRRVADPGTATSDLAEVAARRAL 68

Query: 65  HHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTAD 124
             A +  D +DLIIVAT TPD  FPSTA  +Q+RLG  R   FD++A CSGFVYA+    
Sbjct: 69  EEAGVRPDQVDLIIVATVTPDMPFPSTACLLQDRLGATRAAGFDLEAACSGFVYALAAGA 128

Query: 125 SYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILS 184
            +I +G+   V+V+G++T S+I+DWSDR TCVL GDGAGA +L        +    GIL 
Sbjct: 129 QFIAAGLYDTVLVVGAETLSKIIDWSDRRTCVLLGDGAGAAVLR------PAAPGEGILG 182

Query: 185 TYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFD 236
            YL +DGS  D L    G    P++  TV      ++M G+ VFK+AV+   +  +    
Sbjct: 183 LYLGADGSGGDLLKQPAGGSRLPASPETVARGLHFVQMNGREVFKFAVKTMGDAAQAALA 242

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              LT +++D +VPHQAN+RII S   +  +P ++V+V +D +GNTSAASIP+AL  A+ 
Sbjct: 243 QAGLTFDDVDLYVPHQANFRIIESSARRFDLPLERVVVNIDRYGNTSAASIPVALDEALS 302

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            GR++ G  +LL A GGG T G  ++RW
Sbjct: 303 TGRIRAGQTVLLVAFGGGLTWGAAVVRW 330


>gi|261408038|ref|YP_003244279.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus sp.
           Y412MC10]
 gi|261284501|gb|ACX66472.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus sp.
           Y412MC10]
          Length = 329

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/326 (45%), Positives = 209/326 (64%), Gaps = 16/326 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  +P ++LSNSDLE +VDTSD WI    GI  RHIA  +E T+ L   AA +AL  A
Sbjct: 11  GTGKYVPEKILSNSDLEKMVDTSDEWIVSMTGIRERHIAAPNEATSDLAYHAAVNALKSA 70

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            M  +D++LIIVAT TPD  FPSTA  +Q+RLG K+  AFD+ A CSGFVY + TA +++
Sbjct: 71  GMQAEDLELIIVATITPDMFFPSTACLLQDRLGAKKAAAFDLSAACSGFVYGLATATNFV 130

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALIL-EGVEVKGSSMADTGILSTY 186
           ++G+    +VIG D  SRI D++DR+TCVLFGDGAGA I+ E  E +G    D G     
Sbjct: 131 KTGMYNNALVIGVDCLSRITDYTDRNTCVLFGDGAGAAIVGEVPEGRGFQAFDLG----- 185

Query: 187 LCSDGSYIDKLYVDGG----PSTSRTVGC----IRMEGKAVFKYAVEKAVELIEKVFDST 238
             ++G+    L+++ G    P+++ T+      I M G+ VFK+AV       E V    
Sbjct: 186 --AEGAGGAHLHIEAGGSRLPASAETINTNKHYIYMNGREVFKFAVRVMGTATEAVLSKA 243

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
            +  ++ID FVPHQAN RII S ++++++P +KV++ VD + NTSAAS+PLAL  A + G
Sbjct: 244 GIDKKDIDLFVPHQANIRIIKSAMERLELPEEKVVINVDKYANTSAASVPLALVEAQESG 303

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           R+K+GD +L+   GGG T G+ +L W
Sbjct: 304 RLKEGDKVLMVGFGGGLTWGSSVLIW 329


>gi|82777296|ref|YP_403645.1| 3-oxoacyl-(acyl carrier protein) synthase III [Shigella dysenteriae
           Sd197]
 gi|309788163|ref|ZP_07682769.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Shigella
           dysenteriae 1617]
 gi|123562334|sp|Q32EV1|FABH_SHIDS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|81241444|gb|ABB62154.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Shigella dysenteriae
           Sd197]
 gi|308924015|gb|EFP69516.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Shigella
           dysenteriae 1617]
          Length = 317

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 146/321 (45%), Positives = 205/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+VL+R+
Sbjct: 297 QLVLLEAFGGGFTWGSVLVRF 317


>gi|331652143|ref|ZP_08353162.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           M718]
 gi|331050421|gb|EGI22479.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           M718]
          Length = 317

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 205/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++  ++ +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLEANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|89900519|ref|YP_522990.1| 3-oxoacyl-(acyl carrier protein) synthase III [Rhodoferax
           ferrireducens T118]
 gi|122479403|sp|Q21XP4|FABH_RHOFD RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|89345256|gb|ABD69459.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Rhodoferax
           ferrireducens T118]
          Length = 325

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 165/329 (50%), Positives = 213/329 (64%), Gaps = 14/329 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESI-----VDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S + G G  LP R L+NSDL +      V+TSD WI  R GI  RH A  +  ++ LG
Sbjct: 3   LYSRITGTGSYLPPRRLTNSDLAAELATQGVETSDDWIVERTGIRARHFAAPEVCSSDLG 62

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGF 116
             AAR AL  A     DIDLIIVATSTPD  FPSTA  +Q++LG     AFD+QAVCSGF
Sbjct: 63  LEAARRALQAAGAKAQDIDLIIVATSTPDMVFPSTACILQDKLGANGCPAFDVQAVCSGF 122

Query: 117 VYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSS 176
           +YA++ AD+ I++G  ++ +VIG++ FSRI+D+ DR+TCVLFGDGAGA++LE  +     
Sbjct: 123 IYALSIADAMIKTGAAKKALVIGAEVFSRILDFKDRTTCVLFGDGAGAVVLEASDTP--- 179

Query: 177 MADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKV 234
               GIL++ L +DG ++  L V G  S    +G   ++M+G AVFK AV    E    V
Sbjct: 180 ----GILASDLHADGKHVGILCVPGHVSGGNVLGAPLLQMDGPAVFKLAVGVLDEAARAV 235

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                 T  +IDW +PHQAN RI+ S   K+K+  DKV+VTVD HGNTSAASIPLAL  A
Sbjct: 236 LAKAGKTAADIDWLIPHQANIRIMQSSARKLKLSMDKVVVTVDQHGNTSAASIPLALDAA 295

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           V+ G+VK G+ LLLE +GGGFT G VLL 
Sbjct: 296 VRSGKVKAGELLLLEGVGGGFTWGAVLLN 324


>gi|118199828|gb|ABK78997.1| 3-oxoacyl-[acyl carrier protein] synthase III [Francisella
           tularensis subsp. tularensis]
          Length = 305

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 199/310 (64%), Gaps = 14/310 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP ++L+N D+   VDTSD WIK+RVGI RRH A + ETT+ +   AA+ A
Sbjct: 3   AQILGTGSYLPEKILTNEDISKFVDTSDEWIKQRVGIERRHCASEAETTSYMATHAAKKA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMK--RGFAFDMQAVCSGFVYAVT 121
           L  A+++ +DID+IIVATSTPD   PSTA  +   L +   +   FD+ A CSGFVYA+ 
Sbjct: 63  LEAAQLTANDIDMIIVATSTPDFIMPSTASMVHQNLQIDNFKVRCFDISAACSGFVYALD 122

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            A  YI +GV + ++VIG++  +R++DW+DRSTCVLFGDGAGA+++       S+  +  
Sbjct: 123 IAKQYIETGVSKNILVIGAEKMTRVLDWNDRSTCVLFGDGAGAVVI-------STSQEKK 175

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC-----IRMEGKAVFKYAVEKAVELIEKVFD 236
           ILS+ L +DGS +D L V     TSR         + MEG  VFK+AV +   L +++  
Sbjct: 176 ILSSLLFTDGSCLDMLNVPNNLPTSRGQAINIDPYLIMEGNKVFKFAVSRLSSLADELIQ 235

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              +   +IDW VPHQAN+RI+NS   K+ +P  KV+ T+  HGNTSAASIPLAL  AV+
Sbjct: 236 EAGIKASDIDWLVPHQANYRILNSTAKKIDMPMSKVVTTLQDHGNTSAASIPLALDHAVR 295

Query: 297 EGRVKKGDCL 306
             ++K GD +
Sbjct: 296 TNQIKPGDTI 305


>gi|310815852|ref|YP_003963816.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ketogulonicigenium
           vulgare Y25]
 gi|308754587|gb|ADO42516.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Ketogulonicigenium
           vulgare Y25]
          Length = 268

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/256 (56%), Positives = 187/256 (73%), Gaps = 2/256 (0%)

Query: 69  MSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIR 128
           +   DID IIVAT+TPD TFPS+A  +Q RLGM  GFAFD+QAVC+GFVYA+  A++ I 
Sbjct: 15  LEAGDIDAIIVATATPDLTFPSSATMVQQRLGMTTGFAFDVQAVCAGFVYALANANALII 74

Query: 129 SGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLC 188
           SG   RV+VIG++TF+R++DWSDR+TCVLFGDGAGAL+LEG +  G S  D GIL+T L 
Sbjct: 75  SGQANRVLVIGAETFTRLLDWSDRATCVLFGDGAGALVLEGADGTGDSR-DRGILATDLH 133

Query: 189 SDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWF 248
           SDGSY D LYVDGG +T  T G ++MEG+ VF++AVEK  +      +   L   +IDW 
Sbjct: 134 SDGSYRDLLYVDGGTATGVT-GHLKMEGREVFRHAVEKLAQTARTAVEKAGLEEADIDWV 192

Query: 249 VPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLL 308
           VPHQAN RII +   K+ +P +KVIVTV  HGNTSAASIPLAL+V   +GR++ G+ +++
Sbjct: 193 VPHQANIRIIQATAKKLDVPMEKVIVTVQDHGNTSAASIPLALSVGAADGRLQPGNLIVV 252

Query: 309 EAMGGGFTSGTVLLRW 324
           EA+GGG   G   +RW
Sbjct: 253 EAIGGGLAWGAAAIRW 268


>gi|170768244|ref|ZP_02902697.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia albertii
           TW07627]
 gi|170123010|gb|EDS91941.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia albertii
           TW07627]
          Length = 317

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 205/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPADRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++  ++ +L   
Sbjct: 180 HADGSYGELLTL---PNADRINPENSIYLTMAGNEVFKVAVTELAHIVDETLEANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|304408084|ref|ZP_07389734.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus
           curdlanolyticus YK9]
 gi|304343103|gb|EFM08947.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Paenibacillus
           curdlanolyticus YK9]
          Length = 336

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/324 (42%), Positives = 203/324 (62%), Gaps = 10/324 (3%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           +  IG  +P  +LSN+DLE +V+T   WI RR GI  R IA  DE ++ L   A  D   
Sbjct: 13  ITAIGSYVPESILSNADLEKMVETDHEWIVRRTGIEERRIAAPDEFSSDLCIQAVADLQR 72

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
             ++ +DD+D IIVAT+TPD  FPST+  +Q   GM    A D+QA C+GF  A+  A+ 
Sbjct: 73  RYDVQLDDVDYIIVATTTPDSPFPSTSARLQQAFGMNCSGAIDLQAACAGFTAALQNANG 132

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
            + SG  R+V+V+G+DT S+I D++DRSTC+LFGDGAGAL+LE  E +     +  +L++
Sbjct: 133 LLLSGAARKVLVVGADTMSKITDYTDRSTCILFGDGAGALLLEAEEGR-----EGDLLAS 187

Query: 186 YLCSDGSYIDKLYVDG-----GPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           Y  + GS    +Y+ G     G       G +   G+ V+K+AV    E +EK+ +  HL
Sbjct: 188 YSVTTGSGGHHVYLTGLSEVVGEHKLENPGKVVQNGREVYKWAVGTVPEGVEKLLERAHL 247

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
            +E++DWFVPH AN RI+ SI ++  IP ++ +V++  +GNTS+ASIPLAL +AV+EGR+
Sbjct: 248 QVEDLDWFVPHSANLRIVESICERTGIPMERSLVSLVKYGNTSSASIPLALDLAVREGRL 307

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           + G  +LL   G G T   V++RW
Sbjct: 308 EPGQLMLLYGFGAGLTQAGVIVRW 331


>gi|157160617|ref|YP_001457935.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli HS]
 gi|170020514|ref|YP_001725468.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           ATCC 8739]
 gi|188494765|ref|ZP_03002035.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           53638]
 gi|253773886|ref|YP_003036717.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161197|ref|YP_003044305.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli B
           str. REL606]
 gi|297518140|ref|ZP_06936526.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           OP50]
 gi|300928358|ref|ZP_07143892.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           187-1]
 gi|166971545|sp|A7ZZ48|FABH_ECOHS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|189037893|sp|B1IUH4|FABH_ECOLC RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157066297|gb|ABV05552.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli HS]
 gi|169755442|gb|ACA78141.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli
           ATCC 8739]
 gi|188489964|gb|EDU65067.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           53638]
 gi|242376894|emb|CAQ31612.1| KASIII [Escherichia coli BL21(DE3)]
 gi|253324930|gb|ACT29532.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973098|gb|ACT38769.1| 3-oxoacyl-(acyl carrier protein) synthase [Escherichia coli B str.
           REL606]
 gi|253977312|gb|ACT42982.1| 3-oxoacyl-(acyl carrier protein) synthase [Escherichia coli
           BL21(DE3)]
 gi|300463616|gb|EFK27109.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           187-1]
 gi|323962690|gb|EGB58268.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli H489]
          Length = 317

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 205/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA ++ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAQNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|299067017|emb|CBJ38212.1| 3-oxoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP
           synthase III) (KAS III) [Ralstonia solanacearum CMR15]
          Length = 326

 Score =  280 bits (715), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 208/325 (64%), Gaps = 15/325 (4%)

Query: 8   GIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           G G  LP + ++N +L     E  ++TSD WI  R GI  RH A  D T + L   AA  
Sbjct: 9   GTGSYLPPKRVTNHELAAQLAEKGIETSDEWIVTRSGIRARHYAEPDVTCSDLAVKAAER 68

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGM-KRGFAFDMQAVCSGFVYAVT 121
           A+  A +   +IDLI+VATSTPD  FPS A  +Q +LG+     AFD+QAVCSGFVY + 
Sbjct: 69  AIEAAGIDRAEIDLILVATSTPDFVFPSVACLVQQKLGLSNHCAAFDLQAVCSGFVYGLA 128

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
           TAD +IR+G  R  +VIG++ FSRI+D++DR+TCVLFGDGAGA++L+  +       + G
Sbjct: 129 TADKFIRAGGYRNALVIGAEVFSRILDFNDRTTCVLFGDGAGAVVLQASD-------EPG 181

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGC--IRMEGKAVFKYAVEKAVELIEKVFDSTH 239
           ILST L +DGS+ D L V G  +     G   + M+G+AVFK AV    ++  +      
Sbjct: 182 ILSTALHADGSHADILCVPGNVAGGAIKGSAFLYMDGQAVFKLAVNVLDKVAREALALAE 241

Query: 240 LTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGR 299
           +    IDW +PHQAN RI+     K+ +P ++++VTVD HGNTSAASIPLAL  AV++GR
Sbjct: 242 VESSQIDWLIPHQANIRIMQGTAKKLGLPSERMVVTVDEHGNTSAASIPLALDAAVRDGR 301

Query: 300 VKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++KG  +LLE +GGGFT G  LLR+
Sbjct: 302 IQKGHHVLLEGVGGGFTWGAALLRF 326


>gi|238789114|ref|ZP_04632903.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia frederiksenii
           ATCC 33641]
 gi|238722878|gb|EEQ14529.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Yersinia frederiksenii
           ATCC 33641]
          Length = 302

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 200/310 (64%), Gaps = 14/310 (4%)

Query: 19  SNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLII 78
           SN+DLE +VDTSD WI  R GI  R IAG DET A++G  AA  AL  A +  DDI LII
Sbjct: 3   SNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVATMGFHAAEKALEMAGIDKDDIGLII 62

Query: 79  VATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVI 138
           VAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ AD Y++SG V+  +VI
Sbjct: 63  VATTSSSHAFPSSACQVQQMLGIKDSASFDLAAACAGFTYALSVADQYVKSGAVKYAIVI 122

Query: 139 GSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLY 198
           GSD  SR ++  DR T +LFGDGAGA++L   E       + GI+ST+L +DG Y D L 
Sbjct: 123 GSDVLSRALNPEDRGTIILFGDGAGAVVLGASE-------EQGIISTHLHADGRYGDLLA 175

Query: 199 VDGGPSTSRTV----GCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQAN 254
           +   P   R        + M G  VFK AV +   ++++   + +L    +DW VPHQAN
Sbjct: 176 L---PYQDRQQQDQPAYVTMAGNEVFKVAVTELAHIVDETLQANNLDRSALDWLVPHQAN 232

Query: 255 WRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGG 314
            RII++   K+ +  DKV++T+D HGNTSAAS+P AL  AV++GR+++G  +LLEA GGG
Sbjct: 233 LRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAALDEAVRDGRIQRGQLVLLEAFGGG 292

Query: 315 FTSGTVLLRW 324
           FT G+ L+R+
Sbjct: 293 FTWGSALVRF 302


>gi|218246636|ref|YP_002372007.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cyanothece sp. PCC
           8801]
 gi|218167114|gb|ACK65851.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cyanothece sp. PCC
           8801]
          Length = 333

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/332 (44%), Positives = 207/332 (62%), Gaps = 17/332 (5%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R  + G G + P  V++N DL  +VDTSD WI+ R GI +RH+A  + + + L   AA +
Sbjct: 7   RIAIIGCGSATPTPVMTNDDLAHLVDTSDEWIRTRTGIGQRHLASPEISLSDLCAQAASE 66

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           A+  A ++  +IDLII+ATSTPD  F S A  +Q+ LG     AFD+ A CSGFV+A+ T
Sbjct: 67  AMKMAGLTASEIDLIILATSTPDDLFGS-AARVQHLLGASNAVAFDLTAACSGFVFALVT 125

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A  +IR+GV RRV+VIG+D  SR VDWSDR+TCVLFGDGAGA++ +G      +  +  +
Sbjct: 126 AAQFIRTGVYRRVLVIGADVLSRWVDWSDRTTCVLFGDGAGAVVCQG------TAEEDRL 179

Query: 183 LSTYLCSDGSYIDKLYV----------DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
           L   L SDG   D L +          DG   +  T   I M G+ V+++AV K  E+IE
Sbjct: 180 LGFELYSDGQQHDSLNLAYEGQEKSLKDGLRISQGTYQPITMNGREVYRFAVAKVPEVIE 239

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           K     +L+ ++IDW + HQAN RII+++  ++KIP +KVI  ++ +GNTSAASIPLAL 
Sbjct: 240 KALFRANLSTDDIDWLILHQANQRIIDAVAQRLKIPSEKVIANLEEYGNTSAASIPLALD 299

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV+ G++K GD +     G G T G  + RW
Sbjct: 300 EAVRSGKIKNGDIIATSGFGAGLTWGAAIFRW 331


>gi|197284744|ref|YP_002150616.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Proteus mirabilis
           HI4320]
 gi|194682231|emb|CAR41951.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Proteus mirabilis
           HI4320]
          Length = 317

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 211/322 (65%), Gaps = 8/322 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA ++ET A +G +AA +A
Sbjct: 3   TKILGTGSYLPVQVRTNADLEKMVDTSDEWIVTRTGIHERRIATEEETVAKMGASAAENA 62

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A++   +I LIIVAT++    FPS A  IQ+ LG+    AFD+ A CSGFVYA++ A
Sbjct: 63  LEMADIDRQEIGLIIVATTSGSHAFPSAACQIQHALGIADCIAFDVAAACSGFVYALSIA 122

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +I++G V++ +VIG+D  S  +D +DR T +LFGD AGA+++   E       ++GI+
Sbjct: 123 DQFIKAGTVKQALVIGADRLSHALDPNDRGTIILFGDAAGAVVVGASE-------ESGII 175

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTV-GCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           ST+L SDG + + L +      ++ +   + M G  VFK AV +   ++++  ++ H+  
Sbjct: 176 STHLHSDGRFGELLALPYQDRENQDLPAYVTMAGNEVFKVAVRELAHIVDETLEANHIDK 235

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
             +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++ R+++
Sbjct: 236 SELDWLVPHQANLRIISATAKKLDMTMDKVVVTLDRHGNTSAASVPTALDEAVRDNRIQR 295

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  +LLEA GGGFT G+ L+R+
Sbjct: 296 GQLILLEAFGGGFTWGSALIRF 317


>gi|52841623|ref|YP_095422.1| 3-oxoacyl-(acyl carrier protein) synthase II FabH [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148358924|ref|YP_001250131.1| 3-oxoacyl-(acyl carrier protein) synthase II FabH [Legionella
           pneumophila str. Corby]
 gi|296106972|ref|YP_003618672.1| 3-oxoacyl-(acyl-carrier-protein) [Legionella pneumophila 2300/99
           Alcoy]
 gi|52628734|gb|AAU27475.1| 3-oxoacyl-(acyl carrier protein) synthase II FabH [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|148280697|gb|ABQ54785.1| 3-oxoacyl-(acyl carrier protein) synthase II FabH [Legionella
           pneumophila str. Corby]
 gi|295648873|gb|ADG24720.1| 3-oxoacyl-(acyl-carrier-protein) [Legionella pneumophila 2300/99
           Alcoy]
          Length = 317

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 210/326 (64%), Gaps = 11/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G   P R ++N++LE+++DTSD WI  R GIS R +A + ETT+ +   AA
Sbjct: 1   MKNAVINGTGSYSPERQMTNAELETMLDTSDEWIVTRTGISSRSVAQEHETTSYMASRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
             AL  + +  ++IDLI+VAT TPD  FPS A ++Q+ LG+KR   AFD+ A CSGFVYA
Sbjct: 61  EQALEASGLDAEEIDLILVATCTPDYFFPSVACHVQHALGIKRPIPAFDIGAACSGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +  A  YI +G  + V+V+GS++ SR VDW+DRS CVLFGDGAGA++L   + +G     
Sbjct: 121 MDVAKQYIATGAAKHVLVVGSESMSRAVDWTDRSICVLFGDGAGAVVLSASDRQG----- 175

Query: 180 TGILSTYLCSDGSY-IDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
             I+ + L S  +Y  DKL V    +  +    I M G  VFK AV     ++++V +++
Sbjct: 176 --IMGSVLHS--AYDSDKLLVLRNSTFEQDRATIGMRGNEVFKIAVNIMGNIVDEVLEAS 231

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           HL   +IDW +PHQAN RII +I  K+ +P   VIVT+   GNTSAASIPLAL  ++K  
Sbjct: 232 HLKKSDIDWLIPHQANIRIIQAIAKKLSLPMSHVIVTIGNQGNTSAASIPLALDYSIKNN 291

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++K+ + LL+E+ GGG T G +++R+
Sbjct: 292 QIKRDEILLIESFGGGMTWGAMVIRY 317


>gi|289548672|ref|YP_003473660.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermocrinis albus
           DSM 14484]
 gi|289182289|gb|ADC89533.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Thermocrinis albus
           DSM 14484]
          Length = 307

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 208/321 (64%), Gaps = 16/321 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           +T+ G+G  +P  VL+N DLE +VDTSD WI  R GI  R IA +DE    + + A+  A
Sbjct: 3   TTIVGLGFYVPHHVLTNFDLEKMVDTSDQWITTRTGIKERRIA-RDEDLVDMAQKASVKA 61

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A +  + +D I+VAT TP   FP+ A  +Q R+  +R +A D+ A CSGF+Y +  A
Sbjct: 62  LQMAGVEPNQLDAILVATITPPLGFPAAACLLQQRIEAQRAYALDISAACSGFLYGLELA 121

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D+ I SG  ++V+++G++  S+IVDW DRSTCVLFGDGAGA++L        S  + G+L
Sbjct: 122 DALITSGKAKKVLLVGAEKLSQIVDWQDRSTCVLFGDGAGAVVL--------SQGEGGVL 173

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
           S+ L SDG++ + LY       +   G I+M+G+ +F+ AV    E   +  +   L  +
Sbjct: 174 SSTLRSDGNFWEILY-------APKCGSIKMKGRELFRLAVRSLEEASLEALEKAGLKPQ 226

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
           +ID FVPHQAN RII ++ +K+ IP +K+ + +D +GNTSAASIP+AL+ A  EGR+++G
Sbjct: 227 DIDLFVPHQANVRIIEAVAEKLSIPKEKIYINIDRYGNTSAASIPIALSEAYAEGRLRRG 286

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
           D +LL AMGGG T G +++R+
Sbjct: 287 DTVLLAAMGGGLTWGAMVIRF 307


>gi|171319462|ref|ZP_02908566.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria MEX-5]
 gi|171095313|gb|EDT40296.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Burkholderia
           ambifaria MEX-5]
          Length = 329

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 159/332 (47%), Positives = 218/332 (65%), Gaps = 17/332 (5%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLG 56
           + S V G G  LP   ++N  L     +  ++TSD WI  R GI  RH A +D TT+ L 
Sbjct: 6   LYSRVLGTGSYLPPDRVTNQQLADRLAKEGIETSDEWIVARTGIHARHFAAQDVTTSDLA 65

Query: 57  EAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRG-FAFDMQAVCSG 115
             AAR A+  A++    IDLIIVATSTPD  FPSTA  +QN+LG+K G  AFD+QAVCSG
Sbjct: 66  LEAARRAIEAADIDPQSIDLIIVATSTPDFVFPSTACLLQNKLGIKNGGAAFDVQAVCSG 125

Query: 116 FVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVE---V 172
           F YA+ TADS+IRSG  R  +VIG++TFSRI+D+ DR+TCVLFGDGAGA+IL   +   V
Sbjct: 126 FAYAMATADSFIRSGQHRTALVIGAETFSRILDFKDRTTCVLFGDGAGAVILSASDEPGV 185

Query: 173 KGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIE 232
            GS++   G  S  LC+ G+ +++  +DG          + M+G+AVFK AV    ++  
Sbjct: 186 LGSALHADGSYSHILCTPGN-VNRGVIDGS-------AFLYMDGQAVFKLAVNVLEKVAI 237

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +     +L  E +DW +PHQAN RI+ S   K+ +P ++++VTVD HGNTSAASIPLAL 
Sbjct: 238 EALAKANLAPEQVDWLIPHQANIRIMTSTCRKLGLPQERMVVTVDQHGNTSAASIPLALD 297

Query: 293 VAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            AV++GR+++G  +L+E +GGGFT G  + R+
Sbjct: 298 TAVRDGRIQRGQHVLIEGVGGGFTWGASVFRF 329


>gi|318606157|emb|CBY27655.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 302

 Score =  279 bits (714), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 199/310 (64%), Gaps = 14/310 (4%)

Query: 19  SNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAEMSVDDIDLII 78
           SN+DLE +VDTSD WI  R GI  R IAG DET AS+G  AA  AL  A +  +DI LII
Sbjct: 3   SNADLEKMVDTSDEWIVTRTGIRERRIAGLDETVASMGFHAAEKALEMAGIDKNDIGLII 62

Query: 79  VATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIRSGVVRRVMVI 138
           VAT++    FPS+A  +Q  LG+K   +FD+ A C+GF YA++ AD Y++SG V+  +VI
Sbjct: 63  VATTSSSHAFPSSACQVQQMLGIKDAASFDLAAACAGFTYALSVADQYVKSGAVKHAIVI 122

Query: 139 GSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLY 198
           GSD  SR ++  DR T +LFGDGAGA++L   E         GILST+L +DG Y + L 
Sbjct: 123 GSDVLSRALNPEDRGTIILFGDGAGAVVLGASE-------QPGILSTHLHADGKYGELLA 175

Query: 199 VDGGPSTSR----TVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENIDWFVPHQAN 254
           +   P   R        + M G  VFK AV +   ++++   + +L    +DW VPHQAN
Sbjct: 176 L---PYQDRQHQEQPAYVTMAGNEVFKVAVTELAHIVDETLQANNLDRSALDWLVPHQAN 232

Query: 255 WRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCLLLEAMGGG 314
            RII++   K+ +  DKV++T+D HGNTSAAS+P AL  AV++GR+++G  +LLEA GGG
Sbjct: 233 LRIISATAKKLGMGMDKVVITLDRHGNTSAASVPAALDEAVRDGRIQRGQLVLLEAFGGG 292

Query: 315 FTSGTVLLRW 324
           FT G+ L+R+
Sbjct: 293 FTWGSALVRF 302


>gi|257125402|ref|YP_003163516.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Leptotrichia
           buccalis C-1013-b]
 gi|257049341|gb|ACV38525.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Leptotrichia
           buccalis C-1013-b]
          Length = 325

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 211/330 (63%), Gaps = 16/330 (4%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           ++  + G G  +P ++L+N DL  IVDT+D WI  R GI  R I  ++E T+ L   AA+
Sbjct: 1   MKVGILGTGSYVPEKILTNDDLSKIVDTNDEWITVRTGIKERRIVDENEGTSDLAFRAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
            A+  A++  ++IDL+IVAT TPD   PSTA  +Q++LG+    AFD+ A C+GFVYA T
Sbjct: 61  KAIEDAKIDKNEIDLVIVATMTPDYGTPSTAALVQDKLGINAA-AFDLGAACTGFVYAYT 119

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
              S+I++G+ ++V+VIG++  SR++DW+DR TC+LFGDGAGA++L  VE       + G
Sbjct: 120 AGHSFIKAGIYKKVLVIGAEAMSRVIDWTDRGTCILFGDGAGAVVLGEVE-------NGG 172

Query: 182 ILSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEK 233
            ++++L +DGS   +L V  G    P +   +      ++M G+ +FK+AV    E +E 
Sbjct: 173 YMASHLVADGSGASELLVPAGGTKEPVSKEKIDNKDIYLKMNGREIFKFAVRVFPETVED 232

Query: 234 VFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAV 293
           V     +T +++D F+PHQAN RII SI  + K P DK  V ++ +GNTSA SIP+AL  
Sbjct: 233 VLGQAGITADDVDLFIPHQANIRIIESIAKRFKQPLDKFFVNLNKYGNTSAGSIPIALDE 292

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLLR 323
           A+KEG++KKGD  +    GGG T G++L+ 
Sbjct: 293 AIKEGKLKKGDKFVATGFGGGLTYGSILVE 322


>gi|227357749|ref|ZP_03842098.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Proteus mirabilis
           ATCC 29906]
 gi|227162078|gb|EEI47092.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Proteus mirabilis
           ATCC 29906]
          Length = 321

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 211/322 (65%), Gaps = 8/322 (2%)

Query: 4   STVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDA 63
           + + G G  LP +V +N+DLE +VDTSD WI  R GI  R IA ++ET A +G +AA +A
Sbjct: 7   TKILGTGSYLPVQVRTNADLEKMVDTSDEWIVTRTGIHERRIATEEETVAKMGASAAENA 66

Query: 64  LHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTA 123
           L  A++   +I LIIVAT++    FPS A  IQ+ LG+    AFD+ A CSGFVYA++ A
Sbjct: 67  LEMADIDRQEIGLIIVATTSGSHAFPSAACQIQHALGIADCIAFDVAAACSGFVYALSIA 126

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGIL 183
           D +I++G V++ +VIG+D  S  +D +DR T +LFGD AGA+++   E       ++GI+
Sbjct: 127 DQFIKAGTVKQALVIGADRLSHALDPNDRGTIILFGDAAGAVVVGASE-------ESGII 179

Query: 184 STYLCSDGSYIDKLYVDGGPSTSRTV-GCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTI 242
           ST+L SDG + + L +      ++ +   + M G  VFK AV +   ++++  ++ H+  
Sbjct: 180 STHLHSDGRFGELLALPYQDRENQDLPAYVTMAGNEVFKVAVRELAHIVDETLEANHIDK 239

Query: 243 ENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKK 302
             +DW VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++ R+++
Sbjct: 240 SELDWLVPHQANLRIISATAKKLDMTMDKVVVTLDRHGNTSAASVPTALDEAVRDNRIQR 299

Query: 303 GDCLLLEAMGGGFTSGTVLLRW 324
           G  +LLEA GGGFT G+ L+R+
Sbjct: 300 GQLILLEAFGGGFTWGSALIRF 321


>gi|54294279|ref|YP_126694.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Legionella
           pneumophila str. Lens]
 gi|53754111|emb|CAH15584.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Legionella
           pneumophila str. Lens]
 gi|307610096|emb|CBW99637.1| 3-oxoacyl- [Legionella pneumophila 130b]
          Length = 317

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 210/326 (64%), Gaps = 11/326 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M  + + G G   P R ++N++LE+++DTSD WI  R GIS R +A + ETT+ +   AA
Sbjct: 1   MKNAVISGTGSYSPERQMTNAELETMLDTSDEWIVTRTGISSRSVAQEHETTSYMASRAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGF-AFDMQAVCSGFVYA 119
             AL  + +  ++IDLI+VAT TPD  FPS A ++Q+ LG+KR   AFD+ A CSGFVYA
Sbjct: 61  EQALEASGLDAEEIDLILVATCTPDYFFPSVACHVQHALGIKRPIPAFDIGAACSGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +  A  YI +G  + V+V+GS++ SR VDW+DRS CVLFGDGAGA++L   + +G     
Sbjct: 121 MDVAKQYIATGAAKHVLVVGSESMSRAVDWTDRSICVLFGDGAGAVVLSASDRQG----- 175

Query: 180 TGILSTYLCSDGSY-IDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDST 238
             I+ + L S  +Y  DKL V    +  +    I M G  VFK AV     ++++V +++
Sbjct: 176 --IMGSVLHS--AYDSDKLLVLRNSTFEQDRATIGMRGNEVFKIAVNIMGNIVDEVLEAS 231

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           HL   +IDW +PHQAN RII +I  K+ +P   VIVT+   GNTSAASIPLAL  ++K  
Sbjct: 232 HLKKSDIDWLIPHQANIRIIQAIAKKLSLPMSHVIVTIGNQGNTSAASIPLALDYSIKNN 291

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           ++K+ + LL+E+ GGG T G +++R+
Sbjct: 292 QIKRDEILLIESFGGGMTWGAMVIRY 317


>gi|67922029|ref|ZP_00515545.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Crocosphaera watsonii WH 8501]
 gi|67856245|gb|EAM51488.1| Beta-ketoacyl-acyl carrier protein synthase III (FabH)
           [Crocosphaera watsonii WH 8501]
          Length = 331

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 207/330 (62%), Gaps = 17/330 (5%)

Query: 5   TVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDAL 64
           ++ G G + P +V++N DL  +V+TSD WI+ R GIS+RH+A  D + + L   A   A+
Sbjct: 7   SIIGCGSAAPEQVMTNDDLSLLVETSDEWIRTRTGISKRHLASTDLSLSELSAQAGTQAI 66

Query: 65  HHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTAD 124
             A+++  DIDLII+ATST D  F S A  +Q  L   R  AFD+ A CSGFV+A+ TA 
Sbjct: 67  AMAQLTPGDIDLIILATSTADDLFGS-AAKVQAILQANRAVAFDLTAACSGFVFALITAS 125

Query: 125 SYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILS 184
            ++R+GV + V+VIG+D  SR VDWSDR+TCVLFGDGAGA++ +G+        +  +L 
Sbjct: 126 QFLRTGVYKNVLVIGADILSRWVDWSDRTTCVLFGDGAGAVVCQGI------TEEDNLLG 179

Query: 185 TYLCSDGSYIDKLYV----------DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKV 234
             + SDG   D L +          +G      T   I M+G+ V+++AVEK  E+IEK 
Sbjct: 180 FAMYSDGKQHDALNLGYHGTDKGLKEGIKVNQGTYQPITMKGRDVYRFAVEKVPEVIEKA 239

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
             +  LT ++IDW + HQAN RII+S+  ++KIP +KVI  +D +GNTSAASIPLAL  A
Sbjct: 240 LFNAQLTTDDIDWLILHQANQRIIDSVAKRLKIPGEKVIANLDEYGNTSAASIPLALDEA 299

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           V++G++K GD +     G G T G  + RW
Sbjct: 300 VRQGKIKPGDIVASSGFGAGLTWGAAVFRW 329


>gi|224372473|ref|YP_002606845.1| 3-oxoacyl-(acyl carrier protein) synthase III [Nautilia
           profundicola AmH]
 gi|223589805|gb|ACM93541.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Nautilia
           profundicola AmH]
          Length = 321

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 213/321 (66%), Gaps = 17/321 (5%)

Query: 9   IGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAE 68
           IG  +P ++L+N DLE IVDT+D WI +R GI  RHIA ++E T+ L   AA DAL +A+
Sbjct: 8   IGAYVPEKILTNKDLEKIVDTNDEWITKRTGIKTRHIA-EEEVTSDLAYKAALDALKNAD 66

Query: 69  MSVDDIDLIIVATSTPDQ-TFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
           M  +DID+IIVAT TPD  T PSTA  +  +LG+ R  A D+ A C+GF+YA+  A ++I
Sbjct: 67  MKPEDIDMIIVATITPDYFTMPSTACVVAEKLGIVRP-AVDISAACTGFIYALAHAKAFI 125

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
            SG+ + V++IG++T S+IV+W DR+TCVLFGDGAGA I+   + K  ++ D  I     
Sbjct: 126 ESGMYKNVLIIGAETLSKIVNWKDRTTCVLFGDGAGAAIISATDNKEEAIIDIDI----- 180

Query: 188 CSDGSYIDKLYVDGGPSTSRTVGC------IRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
            +DG + D L     P     +GC      + M+G   FK AV+   + +  + +  ++T
Sbjct: 181 NADGKFQDFLIT---PGRGVKLGCDTDRIWLEMKGNETFKVAVKTLSQSVRDILNRNNMT 237

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            ++IDWF+PHQAN+RII+++   +K+P +K ++TV  +GNTS+ASIP+A+    K G++K
Sbjct: 238 SDDIDWFIPHQANYRIIDAVARAIKMPEEKSVLTVHKYGNTSSASIPMAINDMYKVGKLK 297

Query: 302 KGDCLLLEAMGGGFTSGTVLL 322
           KGD +LL+A GGGFT G+ L+
Sbjct: 298 KGDIMLLDAFGGGFTWGSALV 318


>gi|301168810|emb|CBW28401.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Haemophilus
           influenzae 10810]
          Length = 316

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 139/323 (43%), Positives = 210/323 (65%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S +   G  LP  + +N+DLE +VDTSD WI  R GI  R IA +DET A++G  AA+
Sbjct: 1   MNSRILSTGSYLPSHIRTNADLEKMVDTSDEWIVTRSGIRERRIAAEDETVATMGFEAAK 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A+++  DI+LIIVAT++    +PS A  +Q  L +    +FD+ A C+GFVYA++
Sbjct: 61  NAIEAAQINPQDIELIIVATTSHSHAYPSAACQVQGLLNIDDAISFDLAAACTGFVYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +IR+G V++ +VIGSD  SR +D +DRST VLFGDGAGA+ILE  E +       G
Sbjct: 121 VADQFIRAGKVKKALVIGSDLNSRKLDETDRSTVVLFGDGAGAVILEASEQE-------G 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           I+ST+L +  +  + L +          G I M+G   FK AV +   ++E+   + +L 
Sbjct: 174 IISTHLHASANKNNALVLAQPERGIEKSGYIEMQGNETFKLAVRELSNVVEETLSANNLD 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
            +++DW VPHQAN RII +   K+++   +V+VT+D + N SAA++P+AL  AV++GR++
Sbjct: 234 KKDLDWLVPHQANLRIITATAKKLEMDMSQVVVTLDKYANNSAATVPVALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGG+T G+ L+R+
Sbjct: 294 RGQLLLLEAFGGGWTWGSALVRF 316


>gi|220931869|ref|YP_002508777.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halothermothrix
           orenii H 168]
 gi|219993179|gb|ACL69782.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Halothermothrix
           orenii H 168]
          Length = 331

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 148/330 (44%), Positives = 213/330 (64%), Gaps = 15/330 (4%)

Query: 3   RSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARD 62
           R+TV G+G+ +P ++L+N DLE +VDTSD WI  R GI  R IA  D  T+ L   AAR 
Sbjct: 4   RATVTGVGMYVPPKILTNKDLEKMVDTSDEWITTRTGIKERRIAADDVPTSELALKAARK 63

Query: 63  ALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTT 122
           AL  A++  +++DLI+VAT TPD +FPSTA  +Q +LG  +  AFDM+A CSGFVYA++ 
Sbjct: 64  ALADADLKAEELDLIMVATVTPDMSFPSTACILQEKLGADKAAAFDMEAGCSGFVYAMSV 123

Query: 123 ADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGI 182
           A  +I +G+   +++IG++T S+I DW DRSTCVLFGDGAGA +L+  E       + GI
Sbjct: 124 ASQFIETGMYDNILIIGAETLSKITDWEDRSTCVLFGDGAGAAVLQPTE-------NGGI 176

Query: 183 LSTYLCSDGSYIDKLYVDGG----PSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKV 234
           L+T L +DG+    L++  G    P+   TV      I+MEG  VFK+AV+K  +    V
Sbjct: 177 LATELGADGTGGKSLFMPAGGSLNPADKTTVEEKMHYIKMEGNQVFKFAVKKMGQASLDV 236

Query: 235 FDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVA 294
                L  +++D FVPHQAN RII++   ++ +  D+V V +  +GNTSAAS+P+ALA A
Sbjct: 237 IKKAGLNPDDVDLFVPHQANIRIIDAAAKRLNLTKDRVFVNLPKYGNTSAASVPIALAEA 296

Query: 295 VKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
            +EG +  GD ++L A G G T  + +++W
Sbjct: 297 KEEGLINNGDIIVLVAFGAGLTWASAIIKW 326


>gi|121610193|ref|YP_998000.1| 3-oxoacyl-(acyl carrier protein) synthase III [Verminephrobacter
           eiseniae EF01-2]
 gi|166971604|sp|A1WMX5|FABH_VEREI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|121554833|gb|ABM58982.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Verminephrobacter
           eiseniae EF01-2]
          Length = 325

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 213/327 (65%), Gaps = 14/327 (4%)

Query: 4   STVRGIGLSLPRRVLSNSDL-----ESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           S + G G  LP R L+N+DL     +  ++TSD WI  R GI  RH A  D +++ L   
Sbjct: 5   SRIIGTGSYLPPRRLTNADLVAELGQRGIETSDEWIVERTGIRARHFAAPDVSSSDLALQ 64

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           AAR AL  A +   DIDLIIVATSTPD  FP+ A  +QN+LG     AFD+QAVCSGFVY
Sbjct: 65  AARLALQAAGLQATDIDLIIVATSTPDMVFPAAACILQNKLGANGCPAFDLQAVCSGFVY 124

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A++ ADS +R+G     +V+G++ FSRI+D++DR+TCVLFGDGAGA++L+       + A
Sbjct: 125 ALSVADSMVRAGAANCALVVGAEVFSRILDFNDRTTCVLFGDGAGAVVLQ-------ASA 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVG--CIRMEGKAVFKYAVEKAVELIEKVFD 236
             GIL + L +DG ++  L V G  S  + +G   ++M+G+AVFK A+    +    V  
Sbjct: 178 TPGILCSDLKADGKHVGILCVPGNVSGGQVLGDPVLKMDGQAVFKLAIGVLEQAAHAVLA 237

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              L   ++DW +PHQAN RI+     ++K+  DK++VT+D HGNTSAASIPLAL  AV+
Sbjct: 238 KAGLKPADVDWLIPHQANIRIMQGTARRLKMGMDKMVVTLDQHGNTSAASIPLALDHAVR 297

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLR 323
            GRVK G  LLL+A+GGGFT G VLL+
Sbjct: 298 MGRVKPGQTLLLQAVGGGFTWGAVLLK 324


>gi|209918346|ref|YP_002292430.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           SE11]
 gi|218553668|ref|YP_002386581.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           IAI1]
 gi|218704500|ref|YP_002412019.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           UMN026]
 gi|293404377|ref|ZP_06648371.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           FVEC1412]
 gi|298380156|ref|ZP_06989761.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           FVEC1302]
 gi|300899611|ref|ZP_07117849.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           198-1]
 gi|331662499|ref|ZP_08363422.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA143]
 gi|331672607|ref|ZP_08373396.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA280]
 gi|209911605|dbj|BAG76679.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           SE11]
 gi|218360436|emb|CAQ97990.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           IAI1]
 gi|218431597|emb|CAR12476.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           UMN026]
 gi|281178200|dbj|BAI54530.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           SE15]
 gi|284920916|emb|CBG33979.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           042]
 gi|291428963|gb|EFF01988.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           FVEC1412]
 gi|298279854|gb|EFI21362.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           FVEC1302]
 gi|300356813|gb|EFJ72683.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           198-1]
 gi|324017471|gb|EGB86690.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           117-3]
 gi|331060921|gb|EGI32885.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA143]
 gi|331070250|gb|EGI41616.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA280]
          Length = 317

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLTANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|15642025|ref|NP_231657.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121730626|ref|ZP_01682802.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae V52]
 gi|147673193|ref|YP_001217550.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio cholerae
           O395]
 gi|153820487|ref|ZP_01973154.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae NCTC
           8457]
 gi|227082150|ref|YP_002810701.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae
           M66-2]
 gi|229507888|ref|ZP_04397393.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           BX 330286]
 gi|229511877|ref|ZP_04401356.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           B33]
 gi|229519013|ref|ZP_04408456.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           RC9]
 gi|229607433|ref|YP_002878081.1| 3-oxoacyl-(acyl carrier protein) synthase III [Vibrio cholerae
           MJ-1236]
 gi|254849110|ref|ZP_05238460.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 [Vibrio
           cholerae MO10]
 gi|255745228|ref|ZP_05419177.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholera
           CIRS 101]
 gi|298497947|ref|ZP_07007754.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 [Vibrio
           cholerae MAK 757]
 gi|34098733|sp|Q9KQH5|FABH1_VIBCH RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3 protein
           1; AltName: Full=3-oxoacyl-[acyl-carrier-protein]
           synthase III protein 1; AltName: Full=Beta-ketoacyl-ACP
           synthase III 1; Short=KAS III 1
 gi|9656567|gb|AAF95171.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121627755|gb|EAX60383.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae V52]
 gi|126508969|gb|EAZ71563.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae NCTC
           8457]
 gi|146315076|gb|ABQ19615.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae
           O395]
 gi|227010038|gb|ACP06250.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae
           M66-2]
 gi|227013920|gb|ACP10130.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Vibrio cholerae
           O395]
 gi|229343702|gb|EEO08677.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           RC9]
 gi|229351842|gb|EEO16783.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           B33]
 gi|229355393|gb|EEO20314.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           BX 330286]
 gi|229370088|gb|ACQ60511.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           MJ-1236]
 gi|254844815|gb|EET23229.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 [Vibrio
           cholerae MO10]
 gi|255737058|gb|EET92454.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholera
           CIRS 101]
 gi|297542280|gb|EFH78330.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 protein 1 [Vibrio
           cholerae MAK 757]
          Length = 316

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +V+TSD WI  R GI  R IA  +ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAADNETVADMAFFAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A++ A +   DID+IIVAT++   TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAINMAGIDKHDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGMCKHVLVIGADALSKTCDPTDRSTIILFGDGAGAVVV------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + D L ++       +   + M G  VFK AV +  +L+     + ++ 
Sbjct: 174 ILSTHIHADGEFGDLLSLEVPVRGGDSDKWLHMAGNEVFKVAVTQLSKLVVDTLKANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQMLLLEAFGGGFTWGSALVKF 316


>gi|15801208|ref|NP_287225.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 EDL933]
 gi|15830723|ref|NP_309496.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 str. Sakai]
 gi|16129054|ref|NP_415609.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K-12 substr. MG1655]
 gi|26247231|ref|NP_753271.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           CFT073]
 gi|74311652|ref|YP_310071.1| 3-oxoacyl-(acyl carrier protein) synthase III [Shigella sonnei
           Ss046]
 gi|89107937|ref|AP_001717.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K-12 substr. W3110]
 gi|91210243|ref|YP_540229.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           UTI89]
 gi|110641267|ref|YP_668997.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           536]
 gi|117623276|ref|YP_852189.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           APEC O1]
 gi|157157671|ref|YP_001462323.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           E24377A]
 gi|168759229|ref|ZP_02784236.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|168772063|ref|ZP_02797070.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|168783620|ref|ZP_02808627.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|170080742|ref|YP_001730062.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170680158|ref|YP_001744088.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           SMS-3-5]
 gi|187731777|ref|YP_001880739.1| 3-oxoacyl-(acyl carrier protein) synthase III [Shigella boydii CDC
           3083-94]
 gi|195940638|ref|ZP_03086020.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 str. EC4024]
 gi|208815836|ref|ZP_03257015.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|209397637|ref|YP_002269935.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|215486302|ref|YP_002328733.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217328184|ref|ZP_03444266.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218557972|ref|YP_002390885.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           S88]
 gi|218689043|ref|YP_002397255.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           ED1a]
 gi|218694624|ref|YP_002402291.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           55989]
 gi|218700406|ref|YP_002408035.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           IAI39]
 gi|227886553|ref|ZP_04004358.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           83972]
 gi|237706924|ref|ZP_04537405.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia sp.
           3_2_53FAA]
 gi|238900345|ref|YP_002926141.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           BW2952]
 gi|254792473|ref|YP_003077310.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 str. TW14359]
 gi|256018653|ref|ZP_05432518.1| 3-oxoacyl-(acyl carrier protein) synthase III [Shigella sp. D9]
 gi|256023212|ref|ZP_05437077.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia sp.
           4_1_40B]
 gi|260843331|ref|YP_003221109.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O103:H2 str. 12009]
 gi|260854574|ref|YP_003228465.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O26:H11 str. 11368]
 gi|260867454|ref|YP_003233856.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O111:H- str. 11128]
 gi|261227005|ref|ZP_05941286.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261256239|ref|ZP_05948772.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291282111|ref|YP_003498929.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O55:H7 str. CB9615]
 gi|293409456|ref|ZP_06653032.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli B354]
 gi|293414384|ref|ZP_06657033.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           B185]
 gi|293433380|ref|ZP_06661808.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli B088]
 gi|300816791|ref|ZP_07097011.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           107-1]
 gi|300821130|ref|ZP_07101279.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           119-7]
 gi|300902481|ref|ZP_07120463.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           84-1]
 gi|300918696|ref|ZP_07135275.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           115-1]
 gi|300922616|ref|ZP_07138715.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           182-1]
 gi|300938657|ref|ZP_07153385.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           21-1]
 gi|300948676|ref|ZP_07162757.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           116-1]
 gi|300956247|ref|ZP_07168556.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           175-1]
 gi|300974393|ref|ZP_07172605.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           45-1]
 gi|300982566|ref|ZP_07176188.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           200-1]
 gi|301023276|ref|ZP_07187073.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           69-1]
 gi|301029695|ref|ZP_07192749.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           196-1]
 gi|301051124|ref|ZP_07197956.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           185-1]
 gi|301328541|ref|ZP_07221602.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           78-1]
 gi|301644504|ref|ZP_07244499.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           146-1]
 gi|306814060|ref|ZP_07448233.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           NC101]
 gi|307137726|ref|ZP_07497082.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           H736]
 gi|307310132|ref|ZP_07589782.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli W]
 gi|309796566|ref|ZP_07690973.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           145-7]
 gi|312968832|ref|ZP_07783039.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli 2362-75]
 gi|312971228|ref|ZP_07785406.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli 1827-70]
 gi|331641634|ref|ZP_08342769.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H736]
 gi|331646348|ref|ZP_08347451.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           M605]
 gi|331657152|ref|ZP_08358114.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA206]
 gi|331667491|ref|ZP_08368355.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA271]
 gi|331676881|ref|ZP_08377577.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H591]
 gi|331682594|ref|ZP_08383213.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H299]
 gi|332279722|ref|ZP_08392135.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Shigella sp. D9]
 gi|68566320|sp|P0A6R0|FABH_ECOLI RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III; AltName: Full=EcFabH
 gi|71159322|sp|P0A6R2|FABH_ECO57 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III; AltName: Full=EcFabH
 gi|84028083|sp|P0A6R1|FABH_ECOL6 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III; AltName: Full=EcFabH
 gi|122424173|sp|Q1RD66|FABH_ECOUT RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|122958416|sp|Q0TIY3|FABH_ECOL5 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|123617466|sp|Q3Z326|FABH_SHISS RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166233374|sp|A1A9Y5|FABH_ECOK1 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|166971544|sp|A7ZKJ4|FABH_ECO24 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|12084276|pdb|1HN9|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii
 gi|12084277|pdb|1HN9|B Chain B, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii
 gi|12084278|pdb|1HND|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii-Coa
           Complex
 gi|12084280|pdb|1HNJ|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii +
           Malonyl-Coa
 gi|12084281|pdb|1HNK|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii, Apo
           Tetragonal Form
 gi|149241442|pdb|2EFT|A Chain A, Methanethiol-Cys 112 Inhibition Complex Of E. Coli
           Ketoacyl Synthase Iii (Fabh) And Coenzyme A (High
           Concentration (1.7mm) Soak)
 gi|149241443|pdb|2EFT|B Chain B, Methanethiol-Cys 112 Inhibition Complex Of E. Coli
           Ketoacyl Synthase Iii (Fabh) And Coenzyme A (High
           Concentration (1.7mm) Soak)
 gi|149241767|pdb|2GYO|A Chain A, Methanethiol-Cys 112 Inhibition Complex Of E. Coli
           Ketoacyl Synthase Iii (Fabh) And Coenzyme A
 gi|149241768|pdb|2GYO|B Chain B, Methanethiol-Cys 112 Inhibition Complex Of E. Coli
           Ketoacyl Synthase Iii (Fabh) And Coenzyme A
 gi|12514635|gb|AAG55837.1|AE005319_6 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Escherichia coli O157:H7 str. EDL933]
 gi|26107632|gb|AAN79831.1|AE016759_105 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           CFT073]
 gi|145898|gb|AAA23749.1| beta-ketoacyl-acyl carrier protein synthase III [Escherichia coli]
 gi|1787333|gb|AAC74175.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K-12 substr. MG1655]
 gi|13360933|dbj|BAB34892.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Escherichia coli O157:H7 str. Sakai]
 gi|73855129|gb|AAZ87836.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Shigella sonnei
           Ss046]
 gi|85674835|dbj|BAA35899.2| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K12 substr. W3110]
 gi|91071817|gb|ABE06698.1| 3-oxoacyl-[acyl-carrier-protein] synthase III; acetylCoA ACP
           transacylase [Escherichia coli UTI89]
 gi|110342859|gb|ABG69096.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           536]
 gi|115512400|gb|ABJ00475.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           APEC O1]
 gi|157079701|gb|ABV19409.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           E24377A]
 gi|169888577|gb|ACB02284.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           str. K-12 substr. DH10B]
 gi|170517876|gb|ACB16054.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           SMS-3-5]
 gi|187428769|gb|ACD08043.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Shigella boydii CDC
           3083-94]
 gi|188999057|gb|EDU68043.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4076]
 gi|189354217|gb|EDU72636.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4401]
 gi|189359404|gb|EDU77823.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4486]
 gi|208732484|gb|EDZ81172.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4045]
 gi|209159037|gb|ACI36470.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. EC4115]
 gi|209773228|gb|ACI84926.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209773230|gb|ACI84927.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209773232|gb|ACI84928.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209773234|gb|ACI84929.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|209773236|gb|ACI84930.1| 3-oxoacyl-[acyl-carrier-protein [Escherichia coli]
 gi|215264374|emb|CAS08731.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O127:H6 str. E2348/69]
 gi|217318611|gb|EEC27037.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O157:H7 str. TW14588]
 gi|218351356|emb|CAU97062.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           55989]
 gi|218364741|emb|CAR02431.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           S88]
 gi|218370392|emb|CAR18197.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           IAI39]
 gi|218426607|emb|CAR07435.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           ED1a]
 gi|222032844|emb|CAP75583.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli LF82]
 gi|226898134|gb|EEH84393.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia sp.
           3_2_53FAA]
 gi|227836757|gb|EEJ47223.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           83972]
 gi|238859831|gb|ACR61829.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           BW2952]
 gi|254591873|gb|ACT71234.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O157:H7 str. TW14359]
 gi|257753223|dbj|BAI24725.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O26:H11 str. 11368]
 gi|257758478|dbj|BAI29975.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O103:H2 str. 12009]
 gi|257763810|dbj|BAI35305.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           O111:H- str. 11128]
 gi|260449770|gb|ACX40192.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli
           DH1]
 gi|262176869|gb|ACY27489.1| 3-oxoacyl-acyl-carrier-protein synthase III [Escherichia coli
           LW1655F+]
 gi|290761984|gb|ADD55945.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           O55:H7 str. CB9615]
 gi|291324199|gb|EFE63621.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli B088]
 gi|291434442|gb|EFF07415.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           B185]
 gi|291469924|gb|EFF12408.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli B354]
 gi|294493367|gb|ADE92123.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           IHE3034]
 gi|299877383|gb|EFI85594.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           196-1]
 gi|300297223|gb|EFJ53608.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           185-1]
 gi|300307147|gb|EFJ61667.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           200-1]
 gi|300316916|gb|EFJ66700.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           175-1]
 gi|300397121|gb|EFJ80659.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           69-1]
 gi|300405513|gb|EFJ89051.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           84-1]
 gi|300410636|gb|EFJ94174.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           45-1]
 gi|300414154|gb|EFJ97464.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           115-1]
 gi|300421052|gb|EFK04363.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           182-1]
 gi|300451831|gb|EFK15451.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           116-1]
 gi|300456396|gb|EFK19889.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           21-1]
 gi|300526429|gb|EFK47498.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           119-7]
 gi|300530565|gb|EFK51627.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           107-1]
 gi|300844933|gb|EFK72693.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           78-1]
 gi|301077168|gb|EFK91974.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           146-1]
 gi|305852697|gb|EFM53145.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           NC101]
 gi|306909850|gb|EFN40344.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli W]
 gi|307553092|gb|ADN45867.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli ABU
           83972]
 gi|307627439|gb|ADN71743.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           UM146]
 gi|308119878|gb|EFO57140.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           145-7]
 gi|309701363|emb|CBJ00664.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           ETEC H10407]
 gi|310336430|gb|EFQ01616.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli 1827-70]
 gi|312286234|gb|EFR14147.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli 2362-75]
 gi|312945653|gb|ADR26480.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O83:H1 str. NRG 857C]
 gi|315060368|gb|ADT74695.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli W]
 gi|315135723|dbj|BAJ42882.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli DH1]
 gi|315253891|gb|EFU33859.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           85-1]
 gi|315287419|gb|EFU46830.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           110-3]
 gi|315291053|gb|EFU50416.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           153-1]
 gi|315296652|gb|EFU55947.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           16-3]
 gi|315618262|gb|EFU98852.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli 3431]
 gi|320174242|gb|EFW49403.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Shigella
           dysenteriae CDC 74-1112]
 gi|320179210|gb|EFW54168.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Shigella boydii
           ATCC 9905]
 gi|320189774|gb|EFW64430.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Escherichia coli
           O157:H7 str. EC1212]
 gi|320196426|gb|EFW71049.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Escherichia coli
           WV_060327]
 gi|320637542|gb|EFX07342.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 str. G5101]
 gi|320643103|gb|EFX12304.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H- str. 493-89]
 gi|320648561|gb|EFX17216.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H- str. H 2687]
 gi|320653875|gb|EFX21949.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320659355|gb|EFX26924.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320664490|gb|EFX31641.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323156899|gb|EFZ43033.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Escherichia
           coli EPECa14]
 gi|323165599|gb|EFZ51386.1| 3-oxoacyl-(acyl-carrier-) synthase III family protein [Shigella
           sonnei 53G]
 gi|323175244|gb|EFZ60857.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Escherichia coli LT-68]
 gi|323185786|gb|EFZ71147.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Escherichia coli 1357]
 gi|323379071|gb|ADX51339.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Escherichia coli
           KO11]
 gi|323937831|gb|EGB34095.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           E1520]
 gi|323942560|gb|EGB38727.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli E482]
 gi|323947607|gb|EGB43611.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli H120]
 gi|323953223|gb|EGB49089.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli H252]
 gi|323957915|gb|EGB53627.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli H263]
 gi|324007859|gb|EGB77078.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           57-2]
 gi|324013288|gb|EGB82507.1| 3-oxoacyl-(acyl carrier protein) synthase III [Escherichia coli MS
           60-1]
 gi|324117338|gb|EGC11245.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           E1167]
 gi|326339313|gb|EGD63127.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Escherichia coli
           O157:H7 str. 1125]
 gi|330910906|gb|EGH39416.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KAS3 [Escherichia coli
           AA86]
 gi|331038432|gb|EGI10652.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H736]
 gi|331045100|gb|EGI17227.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           M605]
 gi|331055400|gb|EGI27409.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA206]
 gi|331065076|gb|EGI36971.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           TA271]
 gi|331075570|gb|EGI46868.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H591]
 gi|331080225|gb|EGI51404.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Escherichia coli
           H299]
 gi|332089144|gb|EGI94253.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Shigella boydii 5216-82]
 gi|332092917|gb|EGI97985.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Shigella dysenteriae 155-74]
 gi|332102074|gb|EGJ05420.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Shigella sp. D9]
 gi|332342639|gb|AEE55973.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein FabH
           [Escherichia coli UMNK88]
 gi|333004901|gb|EGK24421.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Shigella flexneri VA-6]
          Length = 317

 Score =  279 bits (713), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|323163633|gb|EFZ49455.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Escherichia coli E128010]
          Length = 316

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 6   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 65

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 66  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 125

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 126 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 178

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 179 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 235

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 236 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 295

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 296 QLVLLEAFGGGFTWGSALVRF 316


>gi|292487953|ref|YP_003530830.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Erwinia amylovora
           CFBP1430]
 gi|292899172|ref|YP_003538541.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Erwinia amylovora
           ATCC 49946]
 gi|291199020|emb|CBJ46131.1| 3-oxoacyl-[acyl-carrier-protein] synthase III [Erwinia amylovora
           ATCC 49946]
 gi|291553377|emb|CBA20422.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Erwinia amylovora
           CFBP1430]
 gi|312172078|emb|CBX80335.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Erwinia amylovora
           ATCC BAA-2158]
          Length = 317

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 204/318 (64%), Gaps = 8/318 (2%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  R IAG +ET A++G  AA  AL  +
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIHERRIAGPNETVATMGFQAAIRALEMS 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  +DI LI+VAT++    FPS+A  IQ  L ++   +FD+ A C+GF YA++ AD YI
Sbjct: 67  GIDKNDIGLIVVATTSSSHAFPSSACMIQQMLEIEDAASFDLAAACAGFTYALSVADQYI 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           ++G V+  +VIG+D  +R++D  DR T +LFGDGAGA++L   E       D GI+ST+L
Sbjct: 127 KNGAVKNALVIGADVLARMLDPDDRGTLILFGDGAGAVVLGASE-------DQGIISTHL 179

Query: 188 CSDGSYIDKLYV-DGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIENID 246
            +DG Y   L + +           + M G  VFK AV +   ++E+   + +L    ID
Sbjct: 180 HADGRYGQLLTLTNQDRQRQENPSYVTMAGNEVFKVAVTELAHIVEETLQANNLDRTAID 239

Query: 247 WFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKGDCL 306
           W VPHQAN RII++   K+ +  DKV+VT+D HGNTSAAS+P AL  AV++GR+++G  +
Sbjct: 240 WLVPHQANLRIISATARKLGMDMDKVVVTLDRHGNTSAASVPSALDEAVRDGRIQRGQLV 299

Query: 307 LLEAMGGGFTSGTVLLRW 324
           LLEA GGGFT G+ L+R+
Sbjct: 300 LLEAFGGGFTWGSALVRF 317


>gi|157736556|ref|YP_001489239.1| 3-oxoacyl-(acyl carrier protein) synthase III [Arcobacter butzleri
           RM4018]
 gi|166971535|sp|A8ERJ6|FABH_ARCB4 RecName: Full=3-oxoacyl-[acyl-carrier-protein] synthase 3; AltName:
           Full=3-oxoacyl-[acyl-carrier-protein] synthase III;
           AltName: Full=Beta-ketoacyl-ACP synthase III; Short=KAS
           III
 gi|157698410|gb|ABV66570.1| 3-oxoacyl-(acyl carrier protein) synthase III [Arcobacter butzleri
           RM4018]
          Length = 333

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 210/333 (63%), Gaps = 14/333 (4%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MI +  R IG  +P +++SN+D E I+DTSD WI +R GI  R IA + E ++ LG  A 
Sbjct: 1   MIYAAFRSIGAYIPPKIMSNADFEKIIDTSDEWITKRTGIKERRIANEGEASSDLGARAG 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPD-QTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYA 119
             A+  A +S ++IDL+I AT TPD    PSTA  I  +LG+    AFD+ A C+GFVYA
Sbjct: 61  ELAIERAAISKEEIDLVICATVTPDFLCMPSTACLIAAKLGLSNVMAFDVSAACTGFVYA 120

Query: 120 VTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMAD 179
           +  A ++I SG+ + V+++G++ +S I+D++DR+TC LFGDGAGA I+     K  S+ D
Sbjct: 121 LNVAKAFIESGMKKNVLIVGAEKYSAILDYTDRTTCFLFGDGAGAAIISATNDKSESIID 180

Query: 180 TGILSTYLCSDGSYIDKLYVDGGPSTS--------RTVGCIRMEGKAVFKYAVEKAVELI 231
                    SDG+Y D +   GG S +          + CI+M+G   FK AV+     +
Sbjct: 181 IN-----CSSDGNYEDLIKTPGGGSKNPCSQEVLENKMACIKMKGNETFKLAVKTLTSDV 235

Query: 232 EKVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLAL 291
           + + +  +LT E+I+ F+PHQAN+RII ++ + + +  +K +VTVD +GNTSAASIP+A+
Sbjct: 236 KTMLEKHNLTNEDINHFIPHQANYRIIKAVGEALDLSDEKTVVTVDKYGNTSAASIPMAM 295

Query: 292 AVAVKEGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
             A ++G++K GD +L +A GGG T G+ L ++
Sbjct: 296 NYAFEQGKIKAGDTILFDAFGGGLTWGSALFKF 328


>gi|229528958|ref|ZP_04418348.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           12129(1)]
 gi|229332732|gb|EEN98218.1| 3-oxoacyl-[acyl-carrier-protein] synthase KASIII [Vibrio cholerae
           12129(1)]
 gi|327484558|gb|AEA78965.1| 3-oxoacyl-[acyl-carrier-protein] synthase, KASIII [Vibrio cholerae
           LMA3894-4]
          Length = 316

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 141/323 (43%), Positives = 215/323 (66%), Gaps = 7/323 (2%)

Query: 2   IRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAAR 61
           + S + G G  LP +V +N+DLE +V+TSD WI  R GI  R IA  +ET A +   AA+
Sbjct: 1   MYSKILGTGSYLPSQVRTNADLEKMVETSDEWIVARTGIRERRIAADNETVADMAFFAAQ 60

Query: 62  DALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVT 121
           +A+  A +   DID+IIVAT++   TFPS A  +Q +LG+K   AFD+ A CSGF+YA++
Sbjct: 61  NAIDMAGIDKHDIDMIIVATTSASHTFPSAACQVQGKLGIKGCPAFDLAAACSGFMYALS 120

Query: 122 TADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTG 181
            AD +++SG+ + V+VIG+D  S+  D +DRST +LFGDGAGA+++      G+S  + G
Sbjct: 121 IADQHVKSGMCKHVLVIGADALSKTCDPTDRSTIILFGDGAGAVVV------GAS-NEPG 173

Query: 182 ILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHLT 241
           ILST++ +DG + D L ++       +   ++M G  VFK AV +  +L+     + ++ 
Sbjct: 174 ILSTHIHADGEFGDLLSLEVPVRGGDSDKWLQMAGNEVFKVAVTQLSKLVVDTLKANNMH 233

Query: 242 IENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVK 301
              +DW VPHQAN+RII++   K+ +  D+V++T+D HGNTSAA++P AL  AV++GR++
Sbjct: 234 KSELDWLVPHQANYRIISATAKKLSMSLDQVVITLDRHGNTSAATVPTALDEAVRDGRIQ 293

Query: 302 KGDCLLLEAMGGGFTSGTVLLRW 324
           +G  LLLEA GGGFT G+ L+++
Sbjct: 294 RGQMLLLEAFGGGFTWGSALVKF 316


>gi|323967032|gb|EGB62458.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli M863]
 gi|327253489|gb|EGE65127.1| 3-oxoacyl-(acyl-carrier-protein) synthase III family protein
           [Escherichia coli STEC_7v]
          Length = 317

 Score =  278 bits (711), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA  +ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIDKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +L   
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|323973320|gb|EGB68509.1| 3-oxoacyl-[acyl-carrier-protein] synthase 3 [Escherichia coli
           TA007]
          Length = 317

 Score =  278 bits (711), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 144/321 (44%), Positives = 204/321 (63%), Gaps = 14/321 (4%)

Query: 8   GIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHA 67
           G G  LP +V +N+DLE +VDTSD WI  R GI  RHIA ++ET +++G  AA  A+  A
Sbjct: 7   GTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAQNETVSTMGFEAATRAIEMA 66

Query: 68  EMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYI 127
            +  D I LI+VAT++    FPS A  IQ+ LG+K   AFD+ A C+GF YA++ AD Y+
Sbjct: 67  GIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALSVADQYV 126

Query: 128 RSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYL 187
           +SG V+  +V+GSD  +R  D +DR T ++FGDGAGA +L   E       + GI+ST+L
Sbjct: 127 KSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASE-------EPGIISTHL 179

Query: 188 CSDGSYIDKLYVDGGPSTSRTVG----CIRMEGKAVFKYAVEKAVELIEKVFDSTHLTIE 243
            +DGSY + L +   P+  R        + M G  VFK AV +   ++++   + +    
Sbjct: 180 HADGSYGELLTL---PNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNFDRS 236

Query: 244 NIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRVKKG 303
            +DW VPHQAN RII++   K+ +  D V+VT+D HGNTSAAS+P AL  AV++GR+K G
Sbjct: 237 QLDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPG 296

Query: 304 DCLLLEAMGGGFTSGTVLLRW 324
             +LLEA GGGFT G+ L+R+
Sbjct: 297 QLVLLEAFGGGFTWGSALVRF 317


>gi|307152597|ref|YP_003887981.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cyanothece sp. PCC
           7822]
 gi|306982825|gb|ADN14706.1| 3-oxoacyl-(acyl-carrier-protein) synthase III [Cyanothece sp. PCC
           7822]
          Length = 333

 Score =  278 bits (711), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 200/329 (60%), Gaps = 17/329 (5%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           + G G + P+++LSN DL  +VDTSD WIK R GIS RH+A  D + + LG  AA  AL 
Sbjct: 10  ITGCGSATPKQILSNEDLSQMVDTSDEWIKTRTGISTRHLASLDNSLSQLGAKAASQALS 69

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +   +IDLI++ATST D  F S A  IQ+ LG  R  AFD+ A CSGFV+ + T   
Sbjct: 70  MAGLEASEIDLIVLATSTADDLFGS-ACQIQSLLGASRAVAFDLTAACSGFVFGLITVAQ 128

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
           +IR GV R V++IG D  SR VDWSDR++CVLFGDGAGA++ +  E +       G+L  
Sbjct: 129 FIRMGVYRNVLLIGGDILSRWVDWSDRNSCVLFGDGAGAVVCQATESR------DGLLGF 182

Query: 186 YLCSDGSYIDKLYVDGGPSTSRTVG----------CIRMEGKAVFKYAVEKAVELIEKVF 235
            +CSDG+Y   L +   P +   V            I M G+ V+++AV K  E+IEK  
Sbjct: 183 EMCSDGNYNSFLNLAYQPQSKSLVHEVSIAQGGYEFITMNGREVYRFAVAKVPEVIEKAL 242

Query: 236 DSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAV 295
               L  +++DW + HQAN RI++++  ++ IP +