RPSBLAST alignment for GI: 254780497 and conserved domain: CHL00203

>gnl|CDD|164577 CHL00203, fabH, 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional. Length = 326
 Score =  277 bits (710), Expect = 3e-75
 Identities = 131/326 (40%), Positives = 197/326 (60%), Gaps = 18/326 (5%)

Query: 9   IGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALHHAE 68
            G S+P   + N   E I++TSD WI  R GI +RH+A    +   L   AA  AL  A 
Sbjct: 8   TGSSVPNFSVENQQFEDIIETSDHWISTRTGIKKRHLAPSSTSLTKLAAEAANKALDKAH 67

Query: 69  MSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADSYIR 128
           M   +IDLII+ATSTPD  F S A  +Q  +G  R  AFD+ A CSGF+ A+ TA  +I+
Sbjct: 68  MDPLEIDLIILATSTPDDLFGS-ASQLQAEIGATRAVAFDITAACSGFILALVTATQFIQ 126

Query: 129 SGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLC 188
           +G  + ++V+G+DT S+ +DWSDR TC+LFGDGAGA I+      G+S  ++ IL   LC
Sbjct: 127 NGSYKNILVVGADTLSKWIDWSDRKTCILFGDGAGAAII------GASYENS-ILGFKLC 179

Query: 189 SDGSYIDKLYVDGGPSTSRTVG----------CIRMEGKAVFKYAVEKAVELIEKVFDST 238
           +DG     L +   P  +++ G           I M GK V+K+AV +   +I K  ++ 
Sbjct: 180 TDGKLNSHLQLMNKPVNNQSFGTTKLPQGQYQSISMNGKEVYKFAVFQVPAVIIKCLNAL 239

Query: 239 HLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEG 298
           +++I+ +DWF+ HQAN RI+ +I +++ +P  K+I  ++ +GNTSAASIPLAL  A++  
Sbjct: 240 NISIDEVDWFILHQANKRILEAIANRLSVPNSKMITNLEKYGNTSAASIPLALDEAIQNN 299

Query: 299 RVKKGDCLLLEAMGGGFTSGTVLLRW 324
           +++ G  ++L   G G T G ++L+W
Sbjct: 300 KIQPGQIIVLSGFGAGLTWGAIVLKW 325