RPSBLAST alignment for GI: 254780497 and conserved domain: PRK12578

>gnl|CDD|183606 PRK12578, PRK12578, acetyl-CoA acetyltransferase; Provisional. Length = 385
 Score = 37.9 bits (88), Expect = 0.003
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 49  DETTASLGEAAARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFD 108
           D +   L   + ++AL+ A +S  DI+L++V ++         A  +    G+       
Sbjct: 18  DVSVQELAWESIKEALNDAGVSQTDIELVVVGSTAYRGIELYPAPIVAEYSGLTGKVPLR 77

Query: 109 MQAVCSGFVYAVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAG 163
           ++A+C+  + A  TA + + SG+V   + +G D  + +    D ST +  G   G
Sbjct: 78  VEAMCATGLAASLTAYTAVASGLVDMAIAVGVDKMTEV----DTSTSLAIGGRGG 128