RPSBLAST alignment for GI: 254780497 and conserved domain: cd00827

>gnl|CDD|29414 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes. They are characterized by the utlization of CoA substrate primers, as well as the nature of their active site residues.. Length = 324
 Score =  180 bits (458), Expect = 4e-46
 Identities = 109/329 (33%), Positives = 163/329 (49%), Gaps = 20/329 (6%)

Query: 6   VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAARDALH 65
           +  IG  LPR  + N +L   +       K   GI +RH+AG DE   ++   AAR AL 
Sbjct: 4   IEAIGAYLPRYRVDNEELAEGL--GVDPGKYTTGIGQRHMAGDDEDVPTMAVEAARRALE 61

Query: 66  HAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAVTTADS 125
            A +  DDI L+IVAT +P     S A  +   LG+    AFD++  C G   A+  A +
Sbjct: 62  RAGIDPDDIGLLIVATESPIDKGKSAATYLAELLGLTNAEAFDLKQACYGGTAALQLAAN 121

Query: 126 YIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILST 185
            + SG  R  +V+ SD  S ++D          GDGA A+++     +   +   GI+ST
Sbjct: 122 LVESGPWRYALVVASDIASYLLDEGSALEPT-LGDGAAAMLVS----RNPGILAAGIVST 176

Query: 186 YLCSDGSYIDKLY--VDGGPSTSRTVGCIR-----MEGKAVFKYAVEKAVELIEKVFDST 238
           +  SD  Y    Y  +DGG      +           G+AVF+ A +   +++ K  D  
Sbjct: 177 HSTSDPGYDFSPYPVMDGGYPKPCKLAYAIRLTAEPAGRAVFEAAHKLIAKVVRKALDRA 236

Query: 239 HLTIENIDWFVPHQAN-WRIINSIVDKMKIPFDKVIVTVDI----HGNTSAASIPLALAV 293
            L+ E+ID+FVPHQ N  +I+ ++  K+  P +K   T  I     GN  AASI L LA 
Sbjct: 237 GLS-EDIDYFVPHQPNGKKILEAVAKKLGGPPEKASQTRWILLRRVGNMYAASILLGLAS 295

Query: 294 AVKEGRVKKGDCLLLEAMGGGFTSGTVLL 322
            ++ G++K GD +LL + G GFT+   +L
Sbjct: 296 LLESGKLKAGDRVLLFSYGSGFTAEAFVL 324