RPSBLAST alignment for GI: 254780497 and conserved domain: COG0332

>gnl|CDD|30680 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein]. Length = 323
 Score =  391 bits (1005), Expect = e-109
 Identities = 186/328 (56%), Positives = 230/328 (70%), Gaps = 10/328 (3%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           M+ + + GIG  LP RV++N+DLE  VDTSD WI+ R GI  R IA  DETT+ L   AA
Sbjct: 1   MMNAKILGIGSYLPERVVTNADLEKRVDTSDEWIETRTGIRERRIAADDETTSDLAVEAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           R AL  A +S DDIDLIIVATSTPD  FPSTA  +Q RLG+    AFD+QA CSGF+YA+
Sbjct: 61  RKALEDAGISPDDIDLIIVATSTPDHLFPSTACLVQARLGLGGAPAFDLQAACSGFLYAL 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           + AD  IRSG  + V+V+G++T SRI+DW+DR TCVLFGDGAGA++LE  E       D 
Sbjct: 121 SVADGLIRSGGYKNVLVVGAETLSRILDWTDRDTCVLFGDGAGAVVLEATED------DN 174

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRT----VGCIRMEGKAVFKYAVEKAVELIEKVFD 236
           GIL T L SDGS  D LY+ GG S +       G + M+G+ VFK+AV    + IE+V +
Sbjct: 175 GILDTDLGSDGSQGDLLYLPGGGSATPKEESGGGLLVMDGREVFKFAVRAMPKAIEEVLE 234

Query: 237 STHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVK 296
              LT E+IDWFVPHQAN RII +I  K+ IP +KV+VTVD +GNTSAASIPLAL  A++
Sbjct: 235 KAGLTPEDIDWFVPHQANLRIIEAIAKKLGIPEEKVVVTVDKYGNTSAASIPLALDEALR 294

Query: 297 EGRVKKGDCLLLEAMGGGFTSGTVLLRW 324
           EGR+K GD +LLEA GGG T G  L+RW
Sbjct: 295 EGRIKPGDLVLLEAFGGGLTWGAALVRW 322