BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780497|ref|YP_003064910.1| 3-oxoacyl-(acyl carrier
protein) synthase III [Candidatus Liberibacter asiaticus str. psy62]
         (324 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780497|ref|YP_003064910.1| 3-oxoacyl-(acyl carrier protein) synthase III [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 324

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60
           MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA
Sbjct: 1   MIRSTVRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEAAA 60

Query: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120
           RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV
Sbjct: 61  RDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVYAV 120

Query: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180
           TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT
Sbjct: 121 TTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADT 180

Query: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240
           GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL
Sbjct: 181 GILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIRMEGKAVFKYAVEKAVELIEKVFDSTHL 240

Query: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300
           TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV
Sbjct: 241 TIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALAVAVKEGRV 300

Query: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324
           KKGDCLLLEAMGGGFTSGTVLLRW
Sbjct: 301 KKGDCLLLEAMGGGFTSGTVLLRW 324


>gi|254780489|ref|YP_003064902.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 325

 Score =  172 bits (436), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 105/315 (33%), Positives = 175/315 (55%), Gaps = 13/315 (4%)

Query: 1   MIRST--VRGIGLSLPRRVLSNSDLESIVDTSDGWIKRRVGISRRHIAGKDETTASLGEA 58
           MI+S+  + G G ++P + + NS +E  ++   G I+++ GI  R+ A K ET   +   
Sbjct: 1   MIKSSSCILGFGHAVPNQCIHNSIIERHLNLKLGVIEQKTGIKYRYWAEKHETLTDIAIQ 60

Query: 59  AARDALHHAEMSVDDIDLIIVATSTPDQTFPSTAVNIQNRLGMKRGFAFDMQAVCSGFVY 118
           A   AL +A +  D I L ++ATSTPD   P ++  I +RLG+ +  A D+   C+GF+Y
Sbjct: 61  AGDIALRNANIKKDSISLTLLATSTPDHLLPPSSPLITHRLGLMQSGAIDLTGACAGFLY 120

Query: 119 AVTTADSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMA 178
           A+  ADSYI S   + V++I ++  SR ++  D+ T ++FGD AGA++L    +K  S  
Sbjct: 121 ALVMADSYINSH-QKPVLIIAANLLSRRINLEDKDTAIIFGDAAGAVVLAPSPLKDKS-- 177

Query: 179 DTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCIR------MEGKAVFKYAVEKAVELIE 232
             GIL   L SDGS  D + +  G STS               G  +F  AV+   +  +
Sbjct: 178 --GILGIELTSDGSKYDLIKIPTGGSTSPAGTNTHDFYMRITNGADIFYNAVKIMAQSAK 235

Query: 233 KVFDSTHLTIENIDWFVPHQANWRIINSIVDKMKIPFDKVIVTVDIHGNTSAASIPLALA 292
           +    + L  ++I+ F+PHQAN RII  + +K+ +    ++ ++   GN+S+ASIPL+L+
Sbjct: 236 QSLRKSDLQPQDINRFIPHQANSRIIQKVCEKIGLSKRIMVNSLKDFGNSSSASIPLSLS 295

Query: 293 VAVKEGRVKKGDCLL 307
           +  +    +KG+ +L
Sbjct: 296 LENQRKPFQKGEKIL 310


>gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 675

 Score = 25.8 bits (55), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%)

Query: 162 AGALILEGVEVKGSSMADTGILSTYLCSDGSYIDKLYVDGGPSTSRTVGCI 212
           A  LIL  +   GS++     LS  + SDG     L   G   T R  GC+
Sbjct: 274 AKDLILNRLASSGSAILKLNTLSEAVSSDGRLRGTLQFYGASRTGRWSGCV 324


>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 423

 Score = 25.0 bits (53), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/61 (19%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 137 VIGSDTFSRIVDWSDRSTCVLFGDGAGALILEGVEVKGSSMADTGILSTYLCSDGSYIDK 196
           ++G ++F  +++   +ST +  G G   ++ +  E+K +++ +  + + +   DG+   K
Sbjct: 348 MLGINSFCAVIN-PPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASK 406

Query: 197 L 197
           L
Sbjct: 407 L 407


>gi|254780533|ref|YP_003064946.1| 3-oxoacyl-(acyl carrier protein) synthase II [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 423

 Score = 24.6 bits (52), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 20/42 (47%)

Query: 124 DSYIRSGVVRRVMVIGSDTFSRIVDWSDRSTCVLFGDGAGAL 165
           D +I  G+V   M +    ++   D    ST V+FG G G L
Sbjct: 78  DQFILYGMVASDMALADSGWAPKTDKDRNSTGVVFGSGMGGL 119



 Score = 23.5 bits (49), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 2/28 (7%)

Query: 144 SRIVDWSDRSTCVLFGDGAGALILEGVE 171
           SR  D  DR   V+ G+GAGAL+LE +E
Sbjct: 228 SRPFD-QDRDGFVM-GEGAGALVLEDLE 253


>gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 380

 Score = 22.7 bits (47), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 10/36 (27%)

Query: 231 IEKVFDSTHLTIENI----------DWFVPHQANWR 256
           I  VF S+  T+++I          +WFV H  NW 
Sbjct: 211 INMVFVSSKHTLKDISFLKRSEIHKEWFVKHLTNWH 246


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.321    0.136    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 200,252
Number of Sequences: 1233
Number of extensions: 8225
Number of successful extensions: 32
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 20
Number of HSP's gapped (non-prelim): 12
length of query: 324
length of database: 328,796
effective HSP length: 74
effective length of query: 250
effective length of database: 237,554
effective search space: 59388500
effective search space used: 59388500
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 38 (19.2 bits)