RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] (167 letters) >gnl|CDD|178323 PLN02721, PLN02721, threonine aldolase. Length = 353 Score = 29.7 bits (67), Expect = 0.37 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 14/62 (22%) Query: 102 LYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINP-----YPKKEGITF 156 LY NG S V P + +EDG +D+ A+ A AI P +P I Sbjct: 93 LYENGGISTLGGV----HPRTVKNNEDGTMDLDAIEA-----AIRPKGDDHFPTTRLICL 143 Query: 157 SN 158 N Sbjct: 144 EN 145 >gnl|CDD|182881 PRK10983, PRK10983, putative inner membrane protein; Provisional. Length = 368 Score = 29.2 bits (66), Expect = 0.52 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 15/56 (26%) Query: 59 VGVRMSGNLYATI-----IQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTS 109 +G+ +SG YAT+ I SC++ L PL + +P+ +LY GDT+ Sbjct: 231 IGLAISGVPYATLLTVLMILSCLVQLGPLP---------VLIPAII-WLYWTGDTT 276 >gnl|CDD|181029 PRK07560, PRK07560, elongation factor EF-2; Reviewed. Length = 731 Score = 27.1 bits (61), Expect = 2.1 Identities = 9/19 (47%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Query: 144 AIN-PYPKKEGITFSNIYD 161 AI+ P +K GI F +I D Sbjct: 209 AISVPMMQKTGIKFKDIID 227 >gnl|CDD|178734 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional. Length = 823 Score = 26.8 bits (59), Expect = 3.2 Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 21 MNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKV 59 M L+ KA+SL+ ++L +QL +S C + L V +KV Sbjct: 341 MCLRFKAESLNQQQLIDQLPKSICKSICQHLFLPVVEKV 379 >gnl|CDD|162296 TIGR01311, glycerol_kin, glycerol kinase. This model describes glycerol kinase, a member of the FGGY family of carbohydrate kinases. Length = 493 Score = 26.0 bits (58), Expect = 4.3 Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 80 EPLLSEVEDTLGCIFVPS 97 E L VED G FVP+ Sbjct: 327 EALARSVEDNGGVYFVPA 344 >gnl|CDD|183176 PRK11523, PRK11523, DNA-binding transcriptional repressor ExuR; Provisional. Length = 253 Score = 26.3 bits (58), Expect = 4.4 Identities = 8/18 (44%), Positives = 12/18 (66%) Query: 33 KKLAEQLGVMSVESWCAD 50 KKL E + +V++WC D Sbjct: 177 KKLHEHIDDRTVDNWCDD 194 >gnl|CDD|185543 PTZ00294, PTZ00294, glycerol kinase-like protein; Provisional. Length = 504 Score = 26.1 bits (58), Expect = 4.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Query: 79 LEPLLSEVEDTLGCIFVPSSSKFLYP 104 +E L V+DT G +FVP+ S P Sbjct: 333 IEKLARSVKDTGGVVFVPAFSGLFAP 358 >gnl|CDD|129401 TIGR00300, TIGR00300, conserved hypothetical protein TIGR00300. All members of the family come from genome projects. A partial length search brings in two plant lysine-ketoglutarate reductase/saccharopine dehydrogenase bifunctional enzymes hitting the N-terminal region of the family. Length = 407 Score = 25.9 bits (57), Expect = 5.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Query: 107 DTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPK 150 D S + +V R+ L +ID+GAVI + + + P+ Sbjct: 45 DPSYARILVSARDHQHLEEILTELIDLGAVIPEIEEVELETAPQ 88 >gnl|CDD|162363 TIGR01444, fkbM_fam, methyltransferase, FkbM family. Members of this family are characterized by two well-conserved short regions separated by a variable in both sequence and length. The first of the two regions is found in a large number of proteins outside this subfamily, a number of which have been characterized as methyltransferases. One member of the present family, FkbM, was shown to be required for a specific methylation in the biosynthesis of the immunosuppressant FK506 in Streptomyces strain MA6548. Length = 143 Score = 25.7 bits (57), Expect = 6.2 Identities = 13/45 (28%), Positives = 17/45 (37%), Gaps = 11/45 (24%) Query: 130 VIDIGAVIADFTA-----------IAINPYPKKEGITFSNIYDTD 163 VID+GA I D + IA P P I N+ + Sbjct: 2 VIDVGANIGDTSLYFARKGAEGRVIAFEPLPDAYEILEENVKLNN 46 >gnl|CDD|182684 PRK10734, PRK10734, putative calcium/sodium:proton antiporter; Provisional. Length = 325 Score = 25.4 bits (56), Expect = 7.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Query: 122 ILPFSEDGVIDIGAVIADFTAIA 144 I+P + VID V+A++ AI+ Sbjct: 185 IMPMATRMVIDNATVLANYFAIS 207 >gnl|CDD|177437 PHA02614, PHA02614, Major capsid protein VP1; Provisional. Length = 363 Score = 25.3 bits (56), Expect = 7.3 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Query: 5 SNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQL--GVMSVESWCAD 50 YP V A P N A LD A+ G VE WC D Sbjct: 165 YKTKYPEGVVA----PKNATNTAQVLDPTAKAKLDKDGAYPVECWCPD 208 >gnl|CDD|163526 TIGR03814, Gln_ase, glutaminase A. This family describes the enzyme glutaminase, from a larger family that includes serine-dependent beta-lactamases and penicillin-binding proteins. Many bacteria have two isozymes. This model is based on selected known glutaminases and their homologs within prokaryotes, with the exclusion of highly-derived (long branch) and architecturally varied homologs, so as to achieve conservative assignments. A sharp drop in scores occurs below 250, and cutoffs are set accordingly. The enzyme converts glutamine to glutamate, with the release of ammonia. Members tend to be described as glutaminase A (glsA), where B (glsB) is unknown and may not be homologous (as in Rhizobium etli). Some species have two isozymes that may both be designated A (GlsA1 and GlsA2). Length = 300 Score = 25.5 bits (57), Expect = 7.6 Identities = 9/19 (47%), Positives = 15/19 (78%) Query: 55 VWKKVGVRMSGNLYATIIQ 73 VW++VGV SG+ + +I+Q Sbjct: 76 VWERVGVEPSGDPFNSIVQ 94 >gnl|CDD|129581 TIGR00490, aEF-2, translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD. Length = 720 Score = 25.2 bits (55), Expect = 8.4 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Query: 127 EDGVIDIGAVIADFTAIAINPYPKKEGITFSNIY 160 EDG + G+ ++ AI++ P KK GI F +IY Sbjct: 194 EDGSVAFGSAYYNW-AISV-PSMKKTGIGFKDIY 225 >gnl|CDD|177932 PLN02295, PLN02295, glycerol kinase. Length = 512 Score = 25.0 bits (55), Expect = 8.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 80 EPLLSEVEDTLGCIFVPSSSKFLYP 104 E L + V+DT G FVP+ S P Sbjct: 335 EALAATVDDTGGVYFVPAFSGLFAP 359 >gnl|CDD|130351 TIGR01284, alt_nitrog_alph, nitrogenase alpha chain. This model represents the alpha chains of various forms of the nitrogen-fixing enzyme nitrogenase: vanadium-iron, iron-iron, and molybdenum-iron. Most examples of NifD, the molybdenum-iron type nitrogenase alpha chain, are excluded from this model and described instead by equivalog model TIGR01282. It appears by phylogenetic and UPGMA trees that this model represents a distinct clade of NifD homologs, in which arose several molybdenum-independent forms. Length = 457 Score = 25.2 bits (55), Expect = 9.4 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 6/79 (7%) Query: 86 VEDTLGCIFVPSSSKFLYPNGDTSGKKNV----VVIREPDILPFSEDGVIDIGAVIADFT 141 +ED LG V S+KF + + V V+I +P+ L E +I+ T Sbjct: 344 LEDELGMEVVAVSTKFGHEDDYEKIIARVREGTVIIDDPNELELEE--IIEKYKPDIILT 401 Query: 142 AIAINPYPKKEGITFSNIY 160 I KK G+ + NI+ Sbjct: 402 GIREGELAKKLGVPYINIH 420 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.134 0.393 Gapped Lambda K H 0.267 0.0838 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,641,648 Number of extensions: 155483 Number of successful extensions: 263 Number of sequences better than 10.0: 1 Number of HSP's gapped: 263 Number of HSP's successfully gapped: 21 Length of query: 167 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 81 Effective length of database: 4,136,185 Effective search space: 335030985 Effective search space used: 335030985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (24.0 bits)