RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] (167 letters) >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, joint center for structural genomics, JCSG; 2.15A {Methylobacillus flagellatus KT} (A:213-409) Length = 197 Score = 26.4 bits (57), Expect = 2.2 Identities = 10/36 (27%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Query: 119 EPDILPFSEDGV-IDIGAVIADFTAIAINPYPKKEG 153 +L FS+ +D GA I + A I K Sbjct: 6 RSGLLRFSDSEKXVDCGASIGESLAGLIGVTKGKFE 41 >3bwr_A Capsid protein VP1; SV40, GM1, viral receptor, viral attachment, ganglioside, polyomaviruses, late protein, nucleus, virion, viral protein; HET: SIA GAL NGA BGC; 2.25A {Simian virus 40} PDB: 3bwq_A* (A:) Length = 272 Score = 26.3 bits (58), Expect = 2.5 Identities = 10/45 (22%), Positives = 16/45 (35%) Query: 6 NYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCAD 50 NY Q V + + + D K + ++ VE W D Sbjct: 142 NYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPD 186 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 25.9 bits (57), Expect = 3.2 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 17/42 (40%) Query: 35 LAEQLGVMSVESWCADVKLSVWKKVGVRMSGNLYATIIQSCV 76 LA+ VMS+ES +V V+ + G+ M Q V Sbjct: 2 LAD---VMSIES-LVEV---VFYR-GMTM---------QVAV 26 >1o63_A ATP phosphoribosyltransferase; structural genomics; 2.00A {Thermotoga maritima} (A:1-65,A:173-219) Length = 112 Score = 25.5 bits (56), Expect = 3.5 Identities = 7/23 (30%), Positives = 10/23 (43%) Query: 114 VVVIREPDILPFSEDGVIDIGAV 136 +R D+ + GV DIG Sbjct: 42 CFXVRPFDVPTYLVHGVADIGFC 64 >1sva_1 Simian virus 40; virus coat protein, icosahedral virus; 3.10A {Simian virus 40} (1:1-321) Length = 321 Score = 25.5 bits (56), Expect = 4.0 Identities = 10/45 (22%), Positives = 16/45 (35%) Query: 6 NYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCAD 50 NY Q V + + + D K + ++ VE W D Sbjct: 167 NYRTKYPAQTVTPKNATVDSQQMNTDHKAVLDKDNAYPVECWVPD 211 >1ve4_A ATP phosphoribosyltransferase; riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.20A {Thermus thermophilus} (A:1-91,A:178-206) Length = 120 Score = 25.1 bits (55), Expect = 5.0 Identities = 7/30 (23%), Positives = 15/30 (50%) Query: 107 DTSGKKNVVVIREPDILPFSEDGVIDIGAV 136 G ++ +R D+ + + G+ +IG V Sbjct: 42 GKEGGVALLELRNKDVPIYVDLGIAEIGVV 71 >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, alternative splicing, cell adhesion, disease mutation, glycoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* (B:614-690) Length = 77 Score = 24.7 bits (54), Expect = 6.1 Identities = 12/49 (24%), Positives = 24/49 (48%), Gaps = 4/49 (8%) Query: 76 VITLEPLLSEVEDTLGCIFVPSSS---KFLYPNGDTSGKKNVVVIREPD 121 + +++ L +D + C + +F Y D+SGK + V+ EP+ Sbjct: 26 IESVKELKDTGKDAVNCTYKNEDDCVVRFQY-YEDSSGKSILYVVEEPE 73 >1z7m_E ATP phosphoribosyltransferase; ATP-PRT, histidine biosynthesis, hiszg, allosteric, evolution; 2.90A {Lactococcus lactis} (E:1-90,E:178-208) Length = 121 Score = 24.7 bits (54), Expect = 7.4 Identities = 9/30 (30%), Positives = 16/30 (53%) Query: 107 DTSGKKNVVVIREPDILPFSEDGVIDIGAV 136 T ++ + D++ F E G++DIG V Sbjct: 39 KTKDDLQIIFGKPNDVITFLEHGIVDIGFV 68 >1nh8_A ATP phosphoribosyltransferase; prtase, de novo His biosynthesis, PRPP, structural genomics, PSI, protein structure initiative; HET: AMP HIS; 1.80A {Mycobacterium tuberculosis H37RV} (A:1-106,A:200-231) Length = 138 Score = 24.4 bits (53), Expect = 8.4 Identities = 6/23 (26%), Positives = 9/23 (39%) Query: 114 VVVIREPDILPFSEDGVIDIGAV 136 +R DI + G +D G Sbjct: 65 FFFLRPKDIAIYVGSGELDFGIT 87 >1sid_A Polyomavirus coat protein VP1; icosahedral virus; HET: SIA GAL BGC; 3.65A {Mouse polyomavirus} (A:1-342) Length = 342 Score = 24.4 bits (53), Expect = 8.5 Identities = 9/42 (21%), Positives = 18/42 (42%) Query: 9 YPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCAD 50 V+++ + M K + + K ++ G+ VE W D Sbjct: 189 GVVTIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPD 230 >1h3d_A ATP-phosphoribosyltransferase; hisitidine biosynthesis, glycosyltransferase; HET: AMP TLA; 2.7A {Escherichia coli} (A:1-100,A:194-224) Length = 131 Score = 24.3 bits (53), Expect = 9.2 Identities = 8/30 (26%), Positives = 17/30 (56%) Query: 107 DTSGKKNVVVIREPDILPFSEDGVIDIGAV 136 + +++ +R+ DI DGV+D+G + Sbjct: 43 AENMPIDILRVRDDDIPGLVMDGVVDLGII 72 >2vd3_A ATP phosphoribosyltransferase; metal-binding, glycosyltransferase, HISG, cytoplasm, histidine, magnesium; HET: HIS; 2.45A {Methanobacterium thermoautotrophicum} (A:1-90,A:185-213) Length = 119 Score = 24.3 bits (53), Expect = 9.5 Identities = 9/23 (39%), Positives = 11/23 (47%) Query: 114 VVVIREPDILPFSEDGVIDIGAV 136 V+ R DI F DG D+G Sbjct: 49 VMFSRAADIPEFVADGAADLGIT 71 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.134 0.393 Gapped Lambda K H 0.267 0.0643 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,230,282 Number of extensions: 51471 Number of successful extensions: 99 Number of sequences better than 10.0: 1 Number of HSP's gapped: 99 Number of HSP's successfully gapped: 15 Length of query: 167 Length of database: 4,956,049 Length adjustment: 82 Effective length of query: 85 Effective length of database: 2,184,039 Effective search space: 185643315 Effective search space used: 185643315 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (23.6 bits)