BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] (167 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780499|ref|YP_003064912.1| hypothetical protein CLIBASIA_01930 [Candidatus Liberibacter asiaticus str. psy62] Length = 167 Score = 343 bits (879), Expect = 1e-96, Method: Compositional matrix adjust. Identities = 167/167 (100%), Positives = 167/167 (100%) Query: 1 MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVG 60 MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVG Sbjct: 1 MRNHSNYSYPVSVQAVFSTPMNLKLKADSLDCKKLAEQLGVMSVESWCADVKLSVWKKVG 60 Query: 61 VRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREP 120 VRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREP Sbjct: 61 VRMSGNLYATIIQSCVITLEPLLSEVEDTLGCIFVPSSSKFLYPNGDTSGKKNVVVIREP 120 Query: 121 DILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN 167 DILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN Sbjct: 121 DILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNIYDTDQLKN 167 >gi|254780916|ref|YP_003065329.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 482 Score = 25.0 bits (53), Expect = 0.75, Method: Compositional matrix adjust. Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 6/32 (18%) Query: 100 KFLYPNGDTSGKKNVVVIREPDILPFSEDGVI 131 KF+ NG T +V+ EPD LP + G I Sbjct: 228 KFIEANGGT------IVLEEPDALPLAVQGRI 253 >gi|254780323|ref|YP_003064736.1| ATP/ADP translocase [Candidatus Liberibacter asiaticus str. psy62] Length = 491 Score = 24.6 bits (52), Expect = 0.94, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 108 TSGKKNVVVIREPDILPFSEDGVIDIGAVIADF 140 T G V VI E +LPF+ED + + +A F Sbjct: 355 TGGGFFVFVIFEDALLPFTEDVIKLVPLALAVF 387 >gi|254780299|ref|YP_003064712.1| acyl-CoA dehydrogenase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 562 Score = 23.9 bits (50), Expect = 1.4, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 15/25 (60%) Query: 82 LLSEVEDTLGCIFVPSSSKFLYPNG 106 +L++VE +GC VP + PNG Sbjct: 245 MLAQVEGRVGCFLVPRLLEDGSPNG 269 >gi|254780268|ref|YP_003064681.1| acetyl-CoA carboxylase biotin carboxylase subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 443 Score = 23.5 bits (49), Expect = 2.1, Method: Compositional matrix adjust. Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 22 NLKLKADSLDCKKLAEQLGV 41 ++K+ D + KK A+QLG+ Sbjct: 109 HIKIMGDKITAKKTAQQLGI 128 >gi|254780186|ref|YP_003064599.1| glutaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.5 bits (49), Expect = 2.3, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 14/19 (73%) Query: 55 VWKKVGVRMSGNLYATIIQ 73 +WK+VG SG+ + +I+Q Sbjct: 81 IWKRVGREPSGSSFDSIVQ 99 >gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Score = 22.3 bits (46), Expect = 4.6, Method: Compositional matrix adjust. Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 5/68 (7%) Query: 100 KFLYPNGDTSGKKNVVVIREPDILPFSEDGVIDIGAVIADFTAIAINPYPKKEGITFSNI 159 K L PNG + K N + IL E +DI ++ + +AI+P K + FSN Sbjct: 58 KILCPNGTKNVKVNTPIAA---ILQEGETA-LDIDKMLLEKPDVAISPSSKNTTLVFSN- 112 Query: 160 YDTDQLKN 167 D D++ + Sbjct: 113 EDNDKVDH 120 >gi|254781152|ref|YP_003065565.1| hypothetical protein CLIBASIA_05295 [Candidatus Liberibacter asiaticus str. psy62] Length = 155 Score = 21.9 bits (45), Expect = 5.3, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 5 SNYSYPVSVQAVFSTPMNL 23 +NYS PV + + P+NL Sbjct: 107 NNYSAPVDFEKINPNPLNL 125 >gi|254780297|ref|YP_003064710.1| peptide deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 170 Score = 21.9 bits (45), Expect = 6.2, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 14/22 (63%) Query: 107 DTSGKKNVVVIREPDILPFSED 128 D + +KN +V P I+ FS+D Sbjct: 65 DHAHRKNPMVFINPKIITFSDD 86 >gi|254780814|ref|YP_003065227.1| DNA gyrase subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Score = 21.6 bits (44), Expect = 7.4, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Query: 53 LSVWKKVGVRMSGNLYATIIQSCVITLEPLL---SEVEDT-LGCIFVPSSSKF 101 LS W K+ ++ GN+Y + ++ PL+ S DT F+PSS F Sbjct: 131 LSSWLKLRIKREGNIYEMSFINGILD-NPLVVTGSAGNDTGTEVTFLPSSDIF 182 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.134 0.393 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,994 Number of Sequences: 1233 Number of extensions: 4179 Number of successful extensions: 12 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 11 length of query: 167 length of database: 328,796 effective HSP length: 68 effective length of query: 99 effective length of database: 244,952 effective search space: 24250248 effective search space used: 24250248 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 35 (18.1 bits)