RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 40.7 bits (95), Expect = 2e-04 Identities = 37/183 (20%), Positives = 60/183 (32%), Gaps = 72/183 (39%) Query: 25 VIGLV--VDYHVSYGSISGAS-LDM-SAISLV---SQG--------SSRS---------H 60 +IG++ Y V+ + G + ++ S + SQG + S Sbjct: 240 LIGVIQLAHYVVT-AKLLGFTPGELRSYLKGATGHSQGLVTAVAIAETDSWESFFVSVRK 298 Query: 61 VIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYIVLKITFGEKGVVS-- 118 I L F I G R + +P L P I+E + E GV S Sbjct: 299 AITVL----FFI---GVRCY---------EAYPNTSLPPSILED---SLENNE-GVPSPM 338 Query: 119 -SVS-MER-------------LP-NRR-----FN-PNPHTIPAPIQTADGF---LRRLLN 153 S+S + + LP ++ N + P Q+ G LR+ Sbjct: 339 LSISNLTQEQVQDYVNKTNSHLPAGKQVEISLVNGAKNLVVSGPPQSLYGLNLTLRKAKA 398 Query: 154 PNG 156 P+G Sbjct: 399 PSG 401 Score = 35.7 bits (82), Expect = 0.005 Identities = 31/149 (20%), Positives = 48/149 (32%), Gaps = 63/149 (42%) Query: 38 SISGAS-------LDMS----------AISLVSQGSSRSHVIESLGSPSFSILHNGNRS- 79 SIS + ++ + ISLV+ +++ V+ G P S L+ N + Sbjct: 340 SISNLTQEQVQDYVNKTNSHLPAGKQVEISLVN--GAKNLVVS--GPPQ-S-LYGLNLTL 393 Query: 80 ----------QS---FYYVSQKKKWFPVKFL-------SPKIMEYIVLKITFGEKGVVSS 119 QS F S++K F +FL S + Sbjct: 394 RKAKAPSGLDQSRIPF---SERKLKFSNRFLPVASPFHSH----LL--------VPASDL 438 Query: 120 VSMERLP--NRRFNPNPHTIPAPIQTADG 146 + + L N FN IP T DG Sbjct: 439 I-NKDLVKNNVSFNAKDIQIPV-YDTFDG 465 >2pxg_A Outer membrane protein; two layer alpha/beta plait, two layer sandwich architecture; NMR {Xanthomonas axonopodis PV} Length = 118 Score = 40.2 bits (94), Expect = 2e-04 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 10/87 (11%) Query: 41 GASLDMSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100 G + +A+ + G S+ V LG+PS + R + Y S ++ Sbjct: 15 GNLIKQNAVEQLQVGQSKQQVSALLGTPSIPDPFHAQR---WDYTSTQRV------DRLA 65 Query: 101 IMEYIVLKITFGEKGVVSSVSMERLPN 127 E + F E V + P+ Sbjct: 66 RTEIKNFTVFF-ENEQVVRWEGDYFPS 91 >2jmb_A AGR_L_42P, hypothetical protein ATU4866; structural genomics, ontario centre for structural proteomics, OCSP, unknown function; NMR {Agrobacterium tumefaciens str} Length = 79 Score = 26.7 bits (59), Expect = 2.2 Identities = 10/15 (66%), Positives = 12/15 (80%) Query: 143 TADGFLRRLLNPNGR 157 TADG +R+ L PNGR Sbjct: 11 TADGRIRQELLPNGR 25 >2p10_A MLL9387 protein; NP_085906.1, hypothetical protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti MAFF303099} SCOP: c.1.12.9 Length = 286 Score = 25.9 bits (57), Expect = 4.0 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Query: 98 SPKIMEYIVLKITFGEKGVVSSVSMERLP 126 +P+ + +L G G + SMERLP Sbjct: 239 NPEDARF-ILDSCQGCHGFYGASSMERLP 266 >3a98_B Engulfment and cell motility protein 1; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} PDB: 2vsz_A Length = 203 Score = 25.9 bits (56), Expect = 4.3 Identities = 16/88 (18%), Positives = 29/88 (32%), Gaps = 8/88 (9%) Query: 8 NNFFFGKLSFNKALFIIVIGLVVDYHVSYGSISGASLDMSAISLVSQGSSRSHVIESLGS 67 + F++ +LS N + L ++ I V G H+ E Sbjct: 48 DKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGAL 107 Query: 68 P--------SFSILHNGNRSQSFYYVSQ 87 +FSIL++ N +F + Sbjct: 108 KQNKEVLELAFSILYDSNCQLNFIAPDK 135 >1z8r_A Coxsackievirus B4 polyprotein; beta barrel coordinated zinc ION, hydrolase; NMR {Human coxsackievirus B4} Length = 166 Score = 25.4 bits (56), Expect = 6.5 Identities = 8/21 (38%), Positives = 13/21 (61%) Query: 83 YYVSQKKKWFPVKFLSPKIME 103 Y+ + K K +PV F P ++E Sbjct: 79 YFCASKSKHYPVSFEGPGLVE 99 >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Score = 25.0 bits (54), Expect = 7.0 Identities = 7/47 (14%), Positives = 16/47 (34%) Query: 53 SQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSP 99 S + + L P ++H G+ + + KW + + Sbjct: 6 SGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNV 52 >3on7_A Oxidoreductase, iron/ascorbate family; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.20A {Shewanella oneidensis} Length = 280 Score = 24.7 bits (53), Expect = 9.0 Identities = 9/43 (20%), Positives = 19/43 (44%), Gaps = 5/43 (11%) Query: 116 VVSSVSMERLPNRR-----FNPNPHTIPAPIQTADGFLRRLLN 153 V++ ++ +R +P+P + + TAD +L L Sbjct: 233 VINPEGTDKTKSRISLPLFLHPHPSVVLSERYTADSYLMERLR 275 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.322 0.137 0.399 Gapped Lambda K H 0.267 0.0504 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,390,776 Number of extensions: 59482 Number of successful extensions: 130 Number of sequences better than 10.0: 1 Number of HSP's gapped: 130 Number of HSP's successfully gapped: 10 Length of query: 159 Length of database: 5,693,230 Length adjustment: 85 Effective length of query: 74 Effective length of database: 3,632,490 Effective search space: 268804260 Effective search space used: 268804260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.7 bits)