RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] (159 letters) >d1ejxc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]} Length = 385 Score = 26.2 bits (58), Expect = 1.4 Identities = 8/38 (21%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 30 VDYHVSY-GSISGASLDMSAISLVSQGSSRSHVIESLG 66 + + V G++ G++ ++ +SQ ++ + V E L Sbjct: 288 IAHEVGMFGAL-GSARHHCRLTFLSQAAAANGVAERLN 324 >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Score = 25.1 bits (54), Expect = 2.7 Identities = 7/48 (14%), Positives = 17/48 (35%) Query: 53 SQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPK 100 S + + L P ++H G+ + + KW + + + Sbjct: 6 SGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQ 53 >d2hrva_ b.47.1.4 (A:) 2A cysteine proteinase {Human rhinovirus 2 [TaxId: 12130]} Length = 139 Score = 24.6 bits (54), Expect = 4.3 Identities = 7/21 (33%), Positives = 10/21 (47%) Query: 83 YYVSQKKKWFPVKFLSPKIME 103 YY K ++FP+ S E Sbjct: 59 YYCKHKNRYFPITVTSHDWYE 79 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.137 0.399 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 597,240 Number of extensions: 25539 Number of successful extensions: 40 Number of sequences better than 10.0: 1 Number of HSP's gapped: 40 Number of HSP's successfully gapped: 3 Length of query: 159 Length of database: 2,407,596 Length adjustment: 78 Effective length of query: 81 Effective length of database: 1,336,656 Effective search space: 108269136 Effective search space used: 108269136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (22.7 bits)