HHsearch alignment of GI: 254780504 and MMDB domain: 1ydw_A_1-133_305-362

>1ydw_A (A:1-133,A:305-362) AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana}
Probab=94.56  E-value=0.072  Score=32.89  Aligned_cols=57  Identities=12%  Similarity=0.244  Sum_probs=41.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCHHHEEECCC
Q ss_conf             69984069568666777777725876443577605667898899999999987389688351242
Q gi|254780504|r  117 RVFYLAMSSAFFGKISQRIHANNLVTEHTRVVLEKPIGSNLSSAQEIHAITRKIFKESQIFRIDH  181 (492)
Q Consensus       117 rifYLAiPP~~f~~i~~~L~~~~l~~~~~RiViEKPFG~Dl~SA~eLn~~l~~~f~E~qiyRIDH  181 (492)
                      -+.|.++|+..=..++...-+.     +.-|++|||++.+++.+++|-+...+.   .-.|.+.+
T Consensus        73 D~V~Iatp~~~H~~~a~~al~~-----GkhVl~EKPla~s~~e~~eL~~~a~~~---gv~~~v~~  129 (191)
T 1ydw_A           73 DALYVPLPTSLHVEWAIKAAEK-----GKHILLEKPVAXNVTEFDKIVDACEAN---GVQIXDGT  129 (191)
T ss_dssp             CEEEECCCGGGHHHHHHHHHTT-----TCEEEECSSCSSSHHHHHHHHHHHHTT---TCCEEECC
T ss_pred             CEEEEECCCCCCCCCCCCCCCC-----CHHEECCCCCCCHHHHHHHHHHHHHCC---CCCCCCCC
T ss_conf             8899712334444322223443-----300000334210036778899876313---43321112