RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780505|ref|YP_003064918.1| 6-phosphogluconolactonase [Candidatus Liberibacter asiaticus str. psy62] (234 letters) >gnl|CDD|73166 cd01400, 6PGL, 6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate. 6PGL is thought to guard against the accumulation of the delta form of the lactone, which may be toxic through its reaction with endogenous cellular nucleophiles.. Length = 219 Score = 185 bits (472), Expect = 7e-48 Identities = 80/222 (36%), Positives = 118/222 (53%), Gaps = 11/222 (4%) Query: 15 LAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELSIIN-VDWHKVVVTLVDERF 73 LA+ LA ++AE L+ I +G S+ALSGG TP+ E L+ +DW KV V L DER Sbjct: 3 LAEALADRIAEALAAAIAKRGRFSLALSGGSTPKPLYELLAAAPALDWSKVHVFLGDERC 62 Query: 74 VPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLI--HFPFDV 131 VP ++ SN + L + A A+ I + E+A +++ L PFD+ Sbjct: 63 VPPDDPDSNYRLAREALLSHVAIPAANIHPIPTELGPEDAAAAYEKELRALFGGVPPFDL 122 Query: 132 VVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKD-YTSNEQRMTMTFSALHDAQFL 190 V+LGMG DGHTAS FP AL T R V+A+ D +R+T+T L++A+ + Sbjct: 123 VLLGMGPDGHTASLFPGHP----ALLEETDRLVVAVTDSPKPPPERITLTLPVLNNARRV 178 Query: 191 ALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHW 232 + G +K L++A++G D E+P +L P EV W Sbjct: 179 VFLVTGAEKAEALKRALAGPDPEELPAARVL---PRPGEVLW 217 >gnl|CDD|30712 COG0363, NagB, 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase [Carbohydrate transport and metabolism]. Length = 238 Score = 164 bits (416), Expect = 2e-41 Identities = 63/232 (27%), Positives = 102/232 (43%), Gaps = 7/232 (3%) Query: 4 YKLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEELS---IINVD 60 KL + E+ + LA+ A+ +A++L +G A +ALSGG TP E L +D Sbjct: 1 MKLIIFEDAEELAKAAAEIIADKLQAAKAERGRAVLALSGGSTPLALYEALVKLPQGQLD 60 Query: 61 WHKVVVTLVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEK 120 W KV + +DER VP ++ SN + + + A FI + + +A A + Sbjct: 61 WSKVTIFNLDERVVPPDDPESNYGLMRRNLFDHIDIPAEFI--HNGDASDPDAECAARYE 118 Query: 121 ICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMT 180 FD+++LGMG DGH AS FP L A V ++R+T+T Sbjct: 119 AKLPSAGGFDLILLGMGEDGHIASLFPGTPALDSATTEEANSRVFVGDSPKVPKERITLT 178 Query: 181 FSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIRAILWNAQSPLEVHW 232 + DA+ + L + G +K L++A+ G P + + Sbjct: 179 LPTILDAKEVLLLVTGEEKADALKQALEGPVTELYPASIL--QLHPNVTWFL 228 >gnl|CDD|38357 KOG3147, KOG3147, KOG3147, 6-phosphogluconolactonase - like protein [Carbohydrate transport and metabolism]. Length = 252 Score = 93.8 bits (233), Expect = 4e-20 Identities = 65/224 (29%), Positives = 108/224 (48%), Gaps = 16/224 (7%) Query: 5 KLYVAENKKRLAQKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEEL---SIINVDW 61 K+ V +++ L + LA +AE+ + +G ++ALSGG + + L ++DW Sbjct: 10 KVIVFSSEEELIEALAGYIAEKSEKALKKRGRFTLALSGGSLIQVLSKLLESPYQDDIDW 69 Query: 62 HKVVVTLVDERFVPLENLRSNQS-FISKFFLQNKAQKASFIPL-YYPQKTIEEAIRIANE 119 K + VDER VPL++ SN F + + P+ EEA + + Sbjct: 70 SKWHIFFVDERVVPLDDPDSNYGLAKRHFLSKVPIPHYNIYPIDESLIADAEEAADLYEK 129 Query: 120 KICQLI---HFP-FDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTS-NE 174 ++ L+ FP FD+++LGMG DGHTAS FP L+ L V+ I D Sbjct: 130 ELKALVANDSFPVFDLLLLGMGPDGHTASLFPGHPLLNEKLKW-----VVPITDSPKPPP 184 Query: 175 QRMTMTFSALHDAQFLALHIEGTQKKHVLEKAISGDDALEMPIR 218 +R+T+T ++ A+ +A + G K ++ KAI D ++P Sbjct: 185 KRITLTLPVINHAKNVAFVVCGASKAEIV-KAILEDKEKKLPAA 227 >gnl|CDD|73165 cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.. Length = 232 Score = 50.5 bits (121), Expect = 4e-07 Identities = 47/215 (21%), Positives = 85/215 (39%), Gaps = 20/215 (9%) Query: 17 QKLAKKVAEQLSIGITNKGTASIALSGGLTPRFFLEEL----SIINVDWHKVVVTLVDER 72 +++++ AE ++ I K A + L+ G TP EEL + + V +DE Sbjct: 1 EEMSEAAAELIAELIREKPPAVLGLATGSTPLGVYEELIELHKEGGLSFSNVTTFNLDE- 59 Query: 73 FVPL--ENLRSNQSFISK-FFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHFPF 129 +V L ++ +S F+ + F + + +E R I + Sbjct: 60 YVGLPPDHPQSYHYFMRENLFDHIDIKPENIHIPDGNAADLEAECRRYEALIAE--AGGI 117 Query: 130 DVVVLGMGIDGHTA------SFFPKGDTLSIALDTHTPRSVIAIKDYTSN--EQRMTMTF 181 D+ +LG+G +GH S + T + LD T ++ D + Q +TM Sbjct: 118 DLQLLGIGENGHIGFNEPGSSLDSR--TRVVTLDESTRQANARFFDGDEDVPTQAITMGI 175 Query: 182 SALHDAQFLALHIEGTQKKHVLEKAISGDDALEMP 216 + A+ + L G K ++KA+ G E P Sbjct: 176 GTIMKAKEILLLATGEGKAEAVKKALEGPVTEECP 210 >gnl|CDD|31350 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion]. Length = 463 Score = 30.6 bits (69), Expect = 0.35 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 22/139 (15%) Query: 72 RFVPLENLRSNQSFISKFFLQNKAQKASFIPLY----YPQKTIEEAIRIANEKICQLIHF 127 R P E +++ S I + QK +P++ P + A +IA + Sbjct: 123 RIYPEEFIQTGISAIDGMNTLVRGQK---LPIFSGSGLPHNEL--AAQIARQATVDGEEE 177 Query: 128 PFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNE---QRMTMTFSAL 184 F VV MGI A FF + ALD R+V+ + +++ +R+ AL Sbjct: 178 EFAVVFAAMGITHEEALFFMDEFEETGALD----RAVLFLN--LADDPAVERIITPRMAL 231 Query: 185 HDAQFLALHIEGTQKKHVL 203 A++LA + HVL Sbjct: 232 TVAEYLAFE----KDMHVL 246 >gnl|CDD|30001 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi apparatus and in other coated vesicles in eukaryotes. Archaea have a protein which is similar in sequence to V-ATPases, but functions like an F-ATPase (called A-ATPase). A similar protein is also found in a few bacteria. This subfamily consists of the non-catalytic beta subunit.. Length = 276 Score = 29.4 bits (66), Expect = 0.99 Identities = 37/139 (26%), Positives = 57/139 (41%), Gaps = 22/139 (15%) Query: 72 RFVPLENLRSNQSFISKFFLQNKAQKASFIPLY----YPQKTIEEAIRIANEKICQLIHF 127 R P E +++ S I + QK IP++ P + A +IA + Sbjct: 46 RIYPEEMIQTGISAIDGMNTLVRGQK---IPIFSGSGLPHNEL--AAQIARQAGVVGEEE 100 Query: 128 PFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNE---QRMTMTFSAL 184 F VV MGI A FF + AL+ R V+ + +N+ +R+ AL Sbjct: 101 NFAVVFAAMGITMEDARFFKDDFEETGALE----RVVLFLN--LANDPTIERIITPRMAL 154 Query: 185 HDAQFLALHIEGTQKKHVL 203 A++LA + KHVL Sbjct: 155 TTAEYLAY----EKGKHVL 169 >gnl|CDD|110200 pfam01182, Glucosamine_iso, Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase. Length = 236 Score = 28.7 bits (64), Expect = 1.4 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 14/158 (8%) Query: 63 KVVVTLVDERFV--PLENLRSNQSFI-SKFFLQNKAQKASFIPLYYPQKTIEEAIRIANE 119 K VVT + +V P E+ S SF+ + FF + L I+ R E Sbjct: 50 KHVVTFNMDEYVGLPPEHPESYHSFMYNNFFNHIDIPPENIHILNGNAADIDAECRNYEE 109 Query: 120 KICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLS--IALDTHTPRSVIAIKDYTSNEQR- 176 KI + + + G+G DGH A F G +L+ + T T ++ A + N+ Sbjct: 110 KIKS--YGKIHLFMGGVGPDGHIA-FNEPGSSLNSRTRIKTLTEDTIKANSRFFDNDVTK 166 Query: 177 -----MTMTFSALHDAQFLALHIEGTQKKHVLEKAISG 209 +T+ L DA+ + + + G QK L+KA+ G Sbjct: 167 VPKYALTVGVGTLLDAEEVMILVLGKQKAFALQKAVEG 204 >gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 352 Score = 27.5 bits (61), Expect = 2.8 Identities = 27/138 (19%), Positives = 49/138 (35%), Gaps = 20/138 (14%) Query: 68 LVDERFVPLENLRSNQSFISKFFLQNKAQKASFIPLYYPQKTIEEAIRIANEKICQLIHF 127 L+DE L+ R + +L+ + + IP+ Y +++E +R+A+ Sbjct: 151 LMDEPLASLDLPRKREILP---YLERLRDEIN-IPILYVSHSLDEVLRLADR-------- 198 Query: 128 PFDVVVLGMGI---DGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMTMTFSAL 184 VVVL G G + D L SV+ ++ R +T AL Sbjct: 199 ---VVVLENGKVKASGPLEEVWGSPD-FPPWLPREEQSSVLEGT-VLEHDPRYGLTALAL 253 Query: 185 HDAQFLALHIEGTQKKHV 202 D ++ + Sbjct: 254 GDQHLWVPKLDAPVGARL 271 >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jnk1 or Jnk2) could survive but disruption of both genes resulted in lethality. However, recent studies have shown that JNK1 and JNK2 perform distinct functions through specific binding partners and substrates. JNK2 is specifically translocated to the mitochondria during dopaminergic cell death. Specific substrates include the microtubule-associated proteins DCX and Tau, as well as TIF-IA which is involved in ribosomal RNA synthesis regulation. Mice deficient in Jnk2 show protection against arthritis, type 1 diabetes, atherosclerosis, abdominal aortic aneurysm, cardiac cell death, TNF-induced liver damage, and tumor growth, indicating that JNK2 may play roles in the pathogenesis of these diseases. Length = 359 Score = 27.7 bits (61), Expect = 3.1 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Query: 99 SFIPLYYPQKTIEE------AIRIANEKICQLIHFPFD 130 S + ++ PQK++EE + + + +CQ+IH D Sbjct: 84 SLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIHMELD 121 >gnl|CDD|36040 KOG0822, KOG0822, KOG0822, Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning]. Length = 649 Score = 27.3 bits (60), Expect = 4.0 Identities = 18/103 (17%), Positives = 33/103 (32%), Gaps = 14/103 (13%) Query: 99 SFIPLYYPQKTIE-----EAIRIANEKICQLIHFPFDVVVLGMGIDGHTASFFPKGDTLS 153 ++ L PQ + N + + + F + G G+ + K LS Sbjct: 514 NYCILAEPQPVFTFEHPNFDFNVDNSR-SKSVEFKVKSNGVLHGFAGYFDAVLYKDIFLS 572 Query: 154 IALDTHTPR------SVIAIKD--YTSNEQRMTMTFSALHDAQ 188 I +THTP +K +++ F D+ Sbjct: 573 IEPNTHTPGMFSWFPIFFPLKQPITVREGSTLSVHFWRCVDST 615 >gnl|CDD|176341 cd01265, PH_PARIS-1, PARIS-1 pleckstrin homology (PH) domain. PARIS-1 pleckstrin homology (PH) domain. PARIS-1 contains a PH domain and a TBC-type GTPase catalytic domain. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. Length = 95 Score = 27.2 bits (60), Expect = 4.5 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 5/68 (7%) Query: 119 EKICQLIHF--PFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQR 176 ++ C L ++ D LG +D A+F + H+ VIA+K S++++ Sbjct: 26 DRTCYLYYYKDSQDAKPLG-RVDLSGAAFTYDPREEKGRFEIHSNNEVIALK--ASSDKQ 82 Query: 177 MTMTFSAL 184 M AL Sbjct: 83 MNYWLQAL 90 >gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins. ALDH subfamily which includes the NAD+-dependent, alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as Antiquitin-1, ALDH7A1, ALDH7B or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), and other similar sequences, such as the uncharacterized aldehyde dehydrogenase of Candidatus kuenenia AldH (locus CAJ73105). Length = 478 Score = 26.8 bits (60), Expect = 5.1 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 95 AQKASFIPLYY--PQKTIEEAIRIANE 119 Q+ +F P+ Y ++EEAI I N+ Sbjct: 375 VQEETFAPILYVIKFDSLEEAIAINND 401 >gnl|CDD|36524 KOG1310, KOG1310, KOG1310, WD40 repeat protein [General function prediction only]. Length = 758 Score = 26.3 bits (57), Expect = 6.9 Identities = 12/51 (23%), Positives = 18/51 (35%) Query: 128 PFDVVVLGMGIDGHTASFFPKGDTLSIALDTHTPRSVIAIKDYTSNEQRMT 178 P + GID + P+ S A H P S + N Q+ + Sbjct: 676 PRCPTLATSGIDSTIKIWSPEATPPSGASRNHRPNSYAIVATNEMNRQQGS 726 >gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like. The 6-oxolauric acid dehydrogenase (CddD) from Rhodococcus ruber SC1 which converts 6-oxolauric acid to dodecanedioic acid, and the aldehyde dehydrogenase (locus SSP0762) from Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 and other similar sequences, are included in this CD. Length = 466 Score = 26.3 bits (59), Expect = 7.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Query: 106 PQKTIEEAIRIAN 118 P +EAI IAN Sbjct: 383 PYDDEDEAIAIAN 395 >gnl|CDD|38358 KOG3148, KOG3148, KOG3148, Glucosamine-6-phosphate isomerase [Carbohydrate transport and metabolism]. Length = 273 Score = 26.2 bits (57), Expect = 7.5 Identities = 27/86 (31%), Positives = 40/86 (46%), Gaps = 9/86 (10%) Query: 130 DVVVLGMGIDGHTASFFPKGDTL-------SIALDTHTPRSVIAIKDYTS-NEQRMTMTF 181 D+ V G+G DGH A F G +L ++A+DT + D T Q +T+ Sbjct: 132 DLFVGGIGPDGHIA-FNEPGSSLVSRTRVKTLAMDTILANARFFDGDLTKVPTQALTVGV 190 Query: 182 SALHDAQFLALHIEGTQKKHVLEKAI 207 + DA+ + + I G K L KAI Sbjct: 191 GTVMDAREVMILITGAHKAFALYKAI 216 >gnl|CDD|143938 pfam00171, Aldedh, Aldehyde dehydrogenase family. This family of dehydrogenases act on aldehyde substrates. Members use NADP as a cofactor. The family includes the following members: The prototypical members are the aldehyde dehydrogenases EC:1.2.1.3. Succinate-semialdehyde dehydrogenase EC:1.2.1.16. Lactaldehyde dehydrogenase EC:1.2.1.22. Benzaldehyde dehydrogenase EC:1.2.1.28. Methylmalonate-semialdehyde dehydrogenase EC:1.2.1.27. Glyceraldehyde-3-phosphate dehydrogenase EC:1.2.1.9. Delta-1-pyrroline-5-carboxylate dehydrogenase EC: 1.5.1.12. Acetaldehyde dehydrogenase EC:1.2.1.10. Glutamate-5-semialdehyde dehydrogenase EC:1.2.1.41. This family also includes omega crystallin, an eye lens protein from squid and octopus that has little aldehyde dehydrogenase activity. Length = 459 Score = 26.0 bits (58), Expect = 9.4 Identities = 6/11 (54%), Positives = 8/11 (72%) Query: 108 KTIEEAIRIAN 118 K +EAI +AN Sbjct: 378 KDEDEAIELAN 388 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0520 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,749,264 Number of extensions: 139693 Number of successful extensions: 438 Number of sequences better than 10.0: 1 Number of HSP's gapped: 430 Number of HSP's successfully gapped: 21 Length of query: 234 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 143 Effective length of database: 4,297,318 Effective search space: 614516474 Effective search space used: 614516474 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.8 bits)