HHsearch alignment for GI: 254780506 and conserved domain: COG0281

>COG0281 SfcA Malic enzyme [Energy production and conversion].
Probab=95.74  E-value=0.11  Score=32.63  Aligned_cols=163  Identities=18%  Similarity=0.208  Sum_probs=108.4

Q ss_pred             HHHHHHHHHHHHH-HHCCCCEEECCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECC-CCCCHHHHHHHHHCCCCCCHHHC
Q ss_conf             7899999999999-983970000247411122669999998523122125888346-88711378898606874351321
Q gi|254780506|r   45 ASCSYVSAKTRMA-KHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLP-LPSTVSEQSIIQSIVPEKDVDGL  122 (306)
Q Consensus        45 aS~~Yv~~K~K~a-~~lGI~~~~~~l~~~~se~el~~~I~~LN~d~~V~GIlvQlP-LP~~id~~~i~~~I~p~KDVDGl  122 (306)
T Consensus        98 ag~pVmeGKa~Lfk~faGid~~pI~ld~~-~~~ei~~~Vkal--~p~FgginLedi~ap~c---f~ie~~lr~~~~IPvF  171 (432)
T COG0281          98 AGKPVMEGKAVLFKAFAGIDVLPIELDVG-TNNEIIEFVKAL--EPTFGGINLEDIDAPRC---FAIEERLRYRMNIPVF  171 (432)
T ss_pred             CCCCHHHHHHHHHHHHCCCCCEEEEEECC-CHHHHHHHHHHH--HHCCCCCCEEECCCCHH---HHHHHHHHHCCCCCCC
T ss_conf             37511252899998734997122676379-828999999973--11379822455556335---7899998634789834


Q ss_pred             CHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCC---CEEECCCCC----
Q ss_conf             5533888730477887567667999999998678772001289961644203468999986204---533124676----
Q gi|254780506|r  123 HVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRNA---TVTMAHSKT----  195 (306)
Q Consensus       123 ~~~N~g~l~~~~~~~~~~PcTp~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~a---tVti~hs~T----  195 (306)
T Consensus       172 hDD----------qqGTaiv~lA~llnalk~~-gk~l~d~kiv~~GAGA-Agiaia~~l~~~g~~~~~i~~~D~~G~l~~  239 (432)
T COG0281         172 HDD----------QQGTAIVTLAALLNALKLT-GKKLKDQKIVINGAGA-AGIAIADLLVAAGVKEENIFVVDRKGLLYD  239 (432)
T ss_pred             CCC----------CCHHHHHHHHHHHHHHHHH-CCCCCCEEEEEECCCH-HHHHHHHHHHHHCCCCCCEEEECCCCCCCC
T ss_conf             545----------3279999999999999984-9972203899967758-899999999982898445899816763458


Q ss_pred             --C----CH---------------HHHHHHCCEEEEECCCCCCCCCCCCCCC
Q ss_conf             --5----34---------------7764223573652244321220104766
Q gi|254780506|r  196 --K----NL---------------PEICRTADILVVAVGRPRMVQVDWIKTG  226 (306)
Q Consensus       196 --~----~l---------------~~~~~~ADivIsAvG~p~~i~~~~vk~g  226 (306)
T Consensus       240 ~r~~~~~~~~k~~~a~~~~~~~~~~~~~~~adv~iG~S~~-G~~t~e~V~~M  290 (432)
T COG0281         240 GREDLTMNQKKYAKAIEDTGERTLDLALAGADVLIGVSGV-GAFTEEMVKEM  290 (432)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCC-CCCCHHHHHHH
T ss_conf             8643442146788777651455511213689889976778-87699999975