HHsearch alignment for GI: 254780506 and conserved domain: COG1052

>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only].
Probab=96.50  E-value=0.0099  Score=39.84  Aligned_cols=225  Identities=13%  Similarity=0.164  Sum_probs=120.6

Q ss_pred             HHHCCCCEEECCCCCCCCHHHHHHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCCC------------CHHHCCH
Q ss_conf             9983970000247411122669999998523122125888346887113788986068743------------5132155
Q gi|254780506|r   57 AKHCGFHSVQYNFPVDISQIDLENAVLSLNKDDSIHGILVQLPLPSTVSEQSIIQSIVPEK------------DVDGLHV  124 (306)
Q Consensus        57 a~~lGI~~~~~~l~~~~se~el~~~I~~LN~d~~V~GIlvQlPLP~~id~~~i~~~I~p~K------------DVDGl~~  124 (306)
T Consensus        16 ~~~l~~~~~~~~~~~~~~~~~--~~~~~---~~~~~~i~~~~--~~~i~~~~l~~~-p~LKlIa~~~~G~D~vDl~aa~~   87 (324)
T COG1052          16 LERLKEKFEVERYEDDLTPDT--ELAER---LKDADAVITFV--NDRIDAEVLEKL-PGLKLIATRSAGYDNVDLEAAKE   87 (324)
T ss_pred             HHHHCCCEEEEEECCCCCCCC--HHHHH---HCCCCEEEECC--CCCCCHHHHHHC-CCCEEEEEECCCCCCCCHHHHHH
T ss_conf             987313578999315776530--57888---64786999726--787589999748-89369999243667504988987


Q ss_pred             HHHHHHHHCCCCCCCCC-CCHHHHHHHH----HH---------------------HCCCCCCCCEEEEECCCCCCHHHHH
Q ss_conf             33888730477887567-6679999999----98---------------------6787720012899616442034689
Q gi|254780506|r  125 VNAGKVMIGDFTTGLVP-CTPAGAILLI----EQ---------------------FKGCDLSGQHAVVIGRSNLFGKPMG  178 (306)
Q Consensus       125 ~N~g~l~~~~~~~~~~P-cTp~av~~ll----~~---------------------y~~i~l~Gk~vvVvGrs~~VG~Pla  178 (306)
T Consensus        88 ~gI---~Vtn-vp~~~t~sVAe~~~aLiLa~~R~~~~~~~~~r~g~w~~~~~~~~~~~~~l~gktvGIiG~Gr-IG~avA  162 (324)
T COG1052          88 RGI---TVTN-VPGYSTEAVAEHAVALILALARRIHEGDRRVREGNWSLSGGPDPLLGFDLRGKTLGIIGLGR-IGQAVA  162 (324)
T ss_pred             CCE---EEEE-CCCCCCHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEEEEECCCH-HHHHHH
T ss_conf             894---9995-89988416999999999998524488999987176332566554444467788889978488-999999


Q ss_pred             HHHHHHCCCEEECCCCCC------------CHHHHHHHCCEEEEECCC----CCCCCCC---CCCCCCEEEEEEEEECCC
Q ss_conf             999862045331246765------------347764223573652244----3212201---047662699831111126
Q gi|254780506|r  179 QLLLSRNATVTMAHSKTK------------NLPEICRTADILVVAVGR----PRMVQVD---WIKTGSLVIDVGINRINS  239 (306)
Q Consensus       179 ~lL~~~~atVti~hs~T~------------~l~~~~~~ADivIsAvG~----p~~i~~~---~vk~gavvIDvGi~~~~~  239 (306)
T Consensus       163 ~r~~~Fgm~v~y~~~~~~~~~~~~~~~~y~~l~ell~~sDii~l~~Plt~~T~hLin~~~l~~mk~ga~lVNtaRG~~VD  242 (324)
T COG1052         163 RRLKGFGMKVLYYDRSPNPEAEKELGARYVDLDELLAESDIISLHCPLTPETRHLINAEELAKMKPGAILVNTARGGLVD  242 (324)
T ss_pred             HHHHCCCCEEEEECCCCCHHHHHHCCCEECCHHHHHHHCCEEEEECCCCHHHHHHCCHHHHHHCCCCEEEEECCCCCEEC
T ss_conf             98721796899866887455574058604168999976999999779983766532999997568976999648742165


Q ss_pred             C-------CCCCCE-EECCCC-HH-H------HHHC----CEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             7-------668856-841775-67-8------7314----40089869868689999999999999998688985
Q gi|254780506|r  240 P-------QLGKTV-LVGDVA-DE-C------KSVV----GAITPVPGGVGPMTIAMLMANTVIAAYRSLGMKSP  294 (306)
Q Consensus       240 ~-------~~~~~~-~~GDvd-~~-~------~~~a----~~iTPVPGGVGp~Tva~L~~N~v~aa~~~~~~~~~  294 (306)
T Consensus       243 e~ALi~AL~~g~i~gaglDV~e~Ep~~~d~~l~~l~~~~~vvltPHia~at~ea~~~m~~~~~~nl~~~~~g~~~  317 (324)
T COG1052         243 EQALIDALKSGKIAGAGLDVFENEPALFDHPLLRLDNFPNVVLTPHIASATEEARKAMAELALENLEAFFDGGVP  317 (324)
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCCCCCHHHHHCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             999999998097422670116788877880676366899879704413020999999999999999999808999