HHsearch alignment for GI: 254780506 and conserved domain: KOG0725

>KOG0725 consensus.
Probab=91.33  E-value=0.29  Score=29.65  Aligned_cols=44  Identities=32%  Similarity=0.421  Sum_probs=30.7

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCCCCCHHH
Q ss_conf             77200128996164420346899998620453312467653477
Q gi|254780506|r  157 CDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSKTKNLPE  200 (306)
Q Consensus       157 i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~T~~l~~  200 (306)
T Consensus         4 ~~l~gkvalVTG~s~GIG~aia~~la~~Ga~v~i~~r~~~~~~~   47 (270)
T KOG0725           4 GRLAGKVALVTGGSSGIGKAIALLLAKAGAKVVITGRSEERLEE   47 (270)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCHHHHHH
T ss_conf             55688789997999815899999999879989998454566677