HHsearch alignment for GI: 254780506 and conserved domain: PRK00676

>PRK00676 hemA glutamyl-tRNA reductase; Validated.
Probab=95.33  E-value=0.14  Score=31.79  Aligned_cols=105  Identities=10%  Similarity=0.011  Sum_probs=66.6

Q ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHC-CCEEECCCCCC-------C--HHHHHHHCCEEEEECCC
Q ss_conf             99999999867877200128996164420346899998620-45331246765-------3--47764223573652244
Q gi|254780506|r  145 AGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPMGQLLLSRN-ATVTMAHSKTK-------N--LPEICRTADILVVAVGR  214 (306)
Q Consensus       145 ~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~-atVti~hs~T~-------~--l~~~~~~ADivIsAvG~  214 (306)
T Consensus       160 ~~~~~~~~~~--~~~~~~~vLvIGaGe-m~~l~~k~L~~~g~~~i~v~NR~~~~~~~~~~~~~~~~~~~~~diii~~ts~  236 (338)
T PRK00676        160 SVVQEELRRR--QKSKKASLLFIGYSE-INRKVAYYLQRQGYSRITFCSRQQLPTPYRTVVREELSFRDPYDVIFFGSSE  236 (338)
T ss_pred             HHHHHHHHHH--CCCCCCEEEEECCCH-HHHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHHCCCCCCCEEEEECCC
T ss_conf             9999999863--786788699986629-9999999998769997999886566665478878775024657889996788


Q ss_pred             CCCCCC-CCC-----CCCCEEEEEEEEECCCCC--CCCCEEECCCCH
Q ss_conf             321220-104-----766269983111112676--688568417756
Q gi|254780506|r  215 PRMVQV-DWI-----KTGSLVIDVGINRINSPQ--LGKTVLVGDVAD  253 (306)
Q Consensus       215 p~~i~~-~~v-----k~gavvIDvGi~~~~~~~--~~~~~~~GDvd~  253 (306)
T Consensus       237 ~~~~~~~~~~e~~~~~~~rliiDLAVPRDI~~~~~~~~~~~l-~IDD  282 (338)
T PRK00676        237 SAYAFPHLSWESLASIPDRIVFDFNVPRTFPWSETPFGHRYL-DMDF  282 (338)
T ss_pred             CCCCCCHHHHHHHHHCCCCEEEEECCCCCCCHHHCCCCCEEE-EHHH
T ss_conf             654565678999871569879995079998710257798998-5886