HHsearch alignment for GI: 254780506 and conserved domain: PRK05579

>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated.
Probab=94.39  E-value=0.2  Score=30.79  Aligned_cols=95  Identities=20%  Similarity=0.335  Sum_probs=65.3

Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHHHHHH-CCCCCCCCEEEEECC----------------CCCCHHHHHHHHHHHCCCEE
Q ss_conf             8887304778875676679999999986-787720012899616----------------44203468999986204533
Q gi|254780506|r  127 AGKVMIGDFTTGLVPCTPAGAILLIEQF-KGCDLSGQHAVVIGR----------------SNLFGKPMGQLLLSRNATVT  189 (306)
Q Consensus       127 ~g~l~~~~~~~~~~PcTp~av~~ll~~y-~~i~l~Gk~vvVvGr----------------s~~VG~Pla~lL~~~~atVt  189 (306)
T Consensus       152 ~G~LAcgd~G~Grl~e-p~~I~~~i~~~l~~~~l~gkkvLITaG~T~E~IDpVR~IsN~SSGkmG~aiA~~a~~~GA~Vt  230 (392)
T PRK05579        152 SGRLACGDVGKGRMAE-PEEIVAAAERLLGPKDLAGKRVLITAGPTREPIDPVRYITNRSSGKMGYALARAAARRGADVT  230 (392)
T ss_pred             CCCCCCCCCCCCCCCC-HHHHHHHHHHHCCCCCCCCCEEEEECCCCEEEECCEEEECCCCCCHHHHHHHHHHHHCCCEEE
T ss_conf             6752463323568999-999999999850677767887999747724776762476657865899999999996799799


Q ss_pred             ECCCCCC----------------CH----HHHHHHCCEEEEECCCCCCCCCCC
Q ss_conf             1246765----------------34----776422357365224432122010
Q gi|254780506|r  190 MAHSKTK----------------NL----PEICRTADILVVAVGRPRMVQVDW  222 (306)
Q Consensus       190 i~hs~T~----------------~l----~~~~~~ADivIsAvG~p~~i~~~~  222 (306)
T Consensus       231 lI~g~~~~~~p~~v~~i~v~ta~eM~~~v~~~~~~~D~~I~aAAVsDf~p~~~  283 (392)
T PRK05579        231 LVSGPVNLPTPAGVKRIDVESAQEMLDAVLAAAQKADIFIMAAAVADYRPATV  283 (392)
T ss_pred             EEECCCCCCCCCCCEEEEECCHHHHHHHHHHHCCCCCEEEEEEEECCEEECCC
T ss_conf             99647877899996799967599999999973544789999301100011454