HHsearch alignment for GI: 254780506 and conserved domain: PRK05653

>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.
Probab=93.88  E-value=0.068  Score=34.00  Aligned_cols=156  Identities=15%  Similarity=0.179  Sum_probs=62.2

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCC-CHHHHHHHHHHHCCC-CCCCEEEEE--CCCCCCHHHHHHHHH
Q ss_conf             9996798678999999999999839700002474111-226699999985231-221258883--468871137889860
Q gi|254780506|r   37 VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDI-SQIDLENAVLSLNKD-DSIHGILVQ--LPLPSTVSEQSIIQS  112 (306)
Q Consensus        37 vIlvGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~-se~el~~~I~~LN~d-~~V~GIlvQ--lPLP~~id~~~i~~~  112 (306)
T Consensus        32 V~~~~r~~~~l---~~~~~~~~~~~~~~~~~~~--Dl~~~~~~~~~~~~~~~~~g~iDilvnnAg~~~~~~~~------~  100 (246)
T PRK05653         32 VVIYDSNEEAA---EALAEELRAAGGEAALLVF--DVTDEAAVRALIEAAVERFGGLDVLVNNAGITRDALLP------R  100 (246)
T ss_pred             EEEEECCHHHH---HHHHHHHHHCCCCEEEEEE--ECCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCCCCCH------H
T ss_conf             99997999999---9999999965994899997--28999999999999999749986999899999998801------3


Q ss_pred             CCCCCCHHHCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH-HHHHHHHCCCEEEC
Q ss_conf             68743513215533888730477887567667999999998678772001289961644203468-99998620453312
Q gi|254780506|r  113 IVPEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPM-GQLLLSRNATVTMA  191 (306)
Q Consensus       113 I~p~KDVDGl~~~N~g~l~~~~~~~~~~PcTp~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pl-a~lL~~~~atVti~  191 (306)
T Consensus       101 ~~~-~~~~~~~~vNl~--------~-~~~~~-~~~~~~m~~~-~---~G~II~isS~~~~~~~~~~~~Y~asKaal~---  162 (246)
T PRK05653        101 MSE-EDWDRVIDTNLT--------G-TFNVC-RAALPPMRKA-R---YGRIVNISSVSGVAGNPGQTNYAAAKAGVI---  162 (246)
T ss_pred             CCH-HHHHHHHHHHHH--------H-HHHHH-HHHHHHHHHH-C---CCCEEEECCHHHCCCCCCCHHHHHHHHHHH---
T ss_conf             999-999999998608--------8-99999-9999999984-6---997899836554678999666899999999---


Q ss_pred             CCCCCCHHHHHHHCCEEEEECCCCCCCCCCCC
Q ss_conf             46765347764223573652244321220104
Q gi|254780506|r  192 HSKTKNLPEICRTADILVVAVGRPRMVQVDWI  223 (306)
Q Consensus       192 hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~v  223 (306)
T Consensus       163 -~lt~~la~e~~~~~IrvN~I-~PG~i~T~~~  192 (246)
T PRK05653        163 -GLTKALALELASRGITVNAV-APGFIDTDMT  192 (246)
T ss_pred             -HHHHHHHHHHHHHCEEEEEE-EECCCCCCCC
T ss_conf             -99999999950439399999-6388877231