HHsearch alignment for GI: 254780506 and conserved domain: PRK05875

>PRK05875 short chain dehydrogenase; Provisional.
Probab=93.52  E-value=0.087  Score=33.30  Aligned_cols=57  Identities=18%  Similarity=0.288  Sum_probs=23.3

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCC-CHHHHHHHHHHHCC-CCCCCEEE
Q ss_conf             9996798678999999999999839700002474111-22669999998523-12212588
Q gi|254780506|r   37 VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDI-SQIDLENAVLSLNK-DDSIHGIL   95 (306)
Q Consensus        37 vIlvGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~-se~el~~~I~~LN~-d~~V~GIl   95 (306)
T Consensus        34 Vii~~r~~~~l~~~~~~l~~~~~~~~~v~~--~~~Dvs~~~~v~~~v~~~~~~~g~iD~LV   92 (277)
T PRK05875         34 VMIVGRNPDKLAAAAEEIEALAGGAGAVRY--EPADVTNEDEVARAVDAATAWHGRLHGVV   92 (277)
T ss_pred             EEEEECCHHHHHHHHHHHHHHCCCCCEEEE--EECCCCCHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             999979889999999999961278862899--95789999999999999999849953999