HHsearch alignment for GI: 254780506 and conserved domain: PRK06113

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated.
Probab=92.90  E-value=0.13  Score=32.02  Aligned_cols=42  Identities=19%  Similarity=0.183  Sum_probs=23.4

Q ss_pred             HHHHHHHCCCEEECCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCCC
Q ss_conf             99998620453312467653477642235736522443212201047
Q gi|254780506|r  178 GQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWIK  224 (306)
Q Consensus       178 a~lL~~~~atVti~hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~vk  224 (306)
T Consensus       157 ~~Y~asKaav~----~ltk~lA~ela~~gIrVN~V~-PG~i~T~~~~  198 (255)
T PRK06113        157 TSYASSKAAAS----HLVRNMAFDLGEKNIRVNGIA-PGAILTDALK  198 (255)
T ss_pred             HHHHHHHHHHH----HHHHHHHHHHHHCCEEEEEEE-ECCCCCCHHH
T ss_conf             20899999999----999999999826494999986-4889870222