HHsearch alignment for GI: 254780506 and conserved domain: PRK06171

>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional.
Probab=90.45  E-value=0.26  Score=30.00  Aligned_cols=71  Identities=15%  Similarity=0.135  Sum_probs=32.2

Q ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH-HHHHHHHHCCCEEECCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCC
Q ss_conf             99999999867877200128996164420346-89999862045331246765347764223573652244321220104
Q gi|254780506|r  145 AGAILLIEQFKGCDLSGQHAVVIGRSNLFGKP-MGQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWI  223 (306)
Q Consensus       145 ~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~P-la~lL~~~~atVti~hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~v  223 (306)
T Consensus       126 ~~~~p~m~~~-~---~G~IVnisS~~g~~g~~~~~~Y~asKaav~----~ltr~lA~ela~~gIrVNaV-~PG~i~t~~~  196 (266)
T PRK06171        126 QAVARQMVKQ-H---DGVIVNMSSEAGLEGSEGQSCYAATKAAVN----SFTRSWAKELGKHGIRVVGV-APGILEATGL  196 (266)
T ss_pred             HHHHHHHHHC-C---CCEEEEECCHHHCCCCCCCHHHHHHHHHHH----HHHHHHHHHHHHCCEEEEEE-EECCCCCCCC
T ss_conf             9999999983-9---957998057775678987589999999999----99999999984549599998-3177166545


Q ss_pred             C
Q ss_conf             7
Q gi|254780506|r  224 K  224 (306)
Q Consensus       224 k  224 (306)
T Consensus       197 ~  197 (266)
T PRK06171        197 R  197 (266)
T ss_pred             C
T ss_conf             6