HHsearch alignment for GI: 254780506 and conserved domain: PRK06227

>PRK06227 consensus.
Probab=90.80  E-value=0.31  Score=29.42  Aligned_cols=159  Identities=17%  Similarity=0.197  Sum_probs=65.1

Q ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCEEECCCCCCC-CHHHHHHHHHHHCCC-CCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             9996798678999999999999839700002474111-226699999985231-22125888346887113788986068
Q gi|254780506|r   37 VVLVGNDPASCSYVSAKTRMAKHCGFHSVQYNFPVDI-SQIDLENAVLSLNKD-DSIHGILVQLPLPSTVSEQSIIQSIV  114 (306)
Q Consensus        37 vIlvGddpaS~~Yv~~K~K~a~~lGI~~~~~~l~~~~-se~el~~~I~~LN~d-~~V~GIlvQlPLP~~id~~~i~~~I~  114 (306)
T Consensus        32 V~i~~~~~~~~~---~~~~~~~~~g~~~~~~~~--Dvs~~~~v~~~~~~~~~~~G~iDiLVNNA----G---------i~   93 (256)
T PRK06227         32 VVIADIDEEAGL---EREEMLRSNGLDALFVKT--DVSDEEDVKNMVRKTVERYGGIDILINNA----G---------IF   93 (256)
T ss_pred             EEEEECCHHHHH---HHHHHHHHCCCCEEEEEC--CCCCHHHHHHHHHHHHHHCCCCCEEEECC----C---------CC
T ss_conf             999969888999---999999955991899981--68999999999999999829997999899----8---------99


Q ss_pred             CCCCHHHCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHH-HHHHHHHHCCCEEECCC
Q ss_conf             74351321553388873047788756766799999999867877200128996164420346-89999862045331246
Q gi|254780506|r  115 PEKDVDGLHVVNAGKVMIGDFTTGLVPCTPAGAILLIEQFKGCDLSGQHAVVIGRSNLFGKP-MGQLLLSRNATVTMAHS  193 (306)
Q Consensus       115 p~KDVDGl~~~N~g~l~~~~~~~~~~PcTp~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~P-la~lL~~~~atVti~hs  193 (306)
T Consensus        94 ~~~~~~~~~~e~w~~~~~vNl~g~f~-~~-~~~~p~m~~~-~---~G~IVnisS~~~~~~~~~~~~Y~asKaav~----~  163 (256)
T PRK06227         94 SGKSIFERTLEEWERVIRVNLTGPYL-CS-KYAAEEMIKN-G---GGVIINIASTRAFQSEPNTEPYSASKGGII----A  163 (256)
T ss_pred             CCCCHHHCCHHHHHHHHHHHHHHHHH-HH-HHHHHHHHHC-C---CCEEEEECCHHHCCCCCCCHHHHHHHHHHH----H
T ss_conf             99890349899999999998299999-99-9999999984-9---977999622554568998688999999999----9


Q ss_pred             CCCCHHHHHHHCCEEEEECCCCCCCCCCCCC
Q ss_conf             7653477642235736522443212201047
Q gi|254780506|r  194 KTKNLPEICRTADILVVAVGRPRMVQVDWIK  224 (306)
Q Consensus       194 ~T~~l~~~~~~ADivIsAvG~p~~i~~~~vk  224 (306)
T Consensus       164 lTr~lA~ela~~gIrVNaV-aPG~i~T~~~~  193 (256)
T PRK06227        164 LTHSLAVSLSKYKIRVVSI-SPGWIETSEWK  193 (256)
T ss_pred             HHHHHHHHHCCCCEEEEEE-ECCCCCCCCCC
T ss_conf             9999999962029499999-61869665000