HHsearch alignment for GI: 254780506 and conserved domain: PRK06718

>PRK06718 precorrin-2 dehydrogenase; Reviewed.
Probab=95.60  E-value=0.028  Score=36.74  Aligned_cols=109  Identities=23%  Similarity=0.356  Sum_probs=67.5

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCC-CCCH-----------------HHHHHHCCEEEEECCCCCC-
Q ss_conf             77200128996164420346899998620453312467-6534-----------------7764223573652244321-
Q gi|254780506|r  157 CDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSK-TKNL-----------------PEICRTADILVVAVGRPRM-  217 (306)
Q Consensus       157 i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~-T~~l-----------------~~~~~~ADivIsAvG~p~~-  217 (306)
T Consensus         6 l~l~gk~vLVVGGG~-vA~rK~~~Ll~~gA~VtVvsp~~~~el~~l~~~~~i~~~~~~~~~~dl~~~~lViaAT~d~~~N   84 (202)
T PRK06718          6 IDLSNKRVVIVGGGK-VAGRRAITLLKYGAHITVISPEITENLVKLVEEGKIRWKEKEFEPSDIVDAFLVIAATNDPRVN   84 (202)
T ss_pred             EECCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHCCCCEEEECCCCHHHHCCCCEEEECCCCHHHH
T ss_conf             982898699988989-9999999998689969998699998999999769944761678866751670445527989999


Q ss_pred             --CCCCCCCCCCEEEEEEEEECCCCCCCCCEEECCCC-HHHHH---HCCEECCCCCCCCHHHHHHHHHH
Q ss_conf             --22010476626998311111267668856841775-67873---14400898698686899999999
Q gi|254780506|r  218 --VQVDWIKTGSLVIDVGINRINSPQLGKTVLVGDVA-DECKS---VVGAITPVPGGVGPMTIAMLMAN  280 (306)
Q Consensus       218 --i~~~~vk~gavvIDvGi~~~~~~~~~~~~~~GDvd-~~~~~---~a~~iTPVPGGVGp~Tva~L~~N  280 (306)
T Consensus        85 ~~i~-~~~~~~~l-v----NvvD~p~~~------dFi~Paiv~rg~l~IaIS--T~G~SP~lAr~iR~~  139 (202)
T PRK06718         85 EAVA-EALPENAL-F----NVIGDAESG------NVVFPSALHRGKLTISVS--TDGASPKLAKKIRDE  139 (202)
T ss_pred             HHHH-HHHHHCCC-E----EECCCCCCC------EEEEEEEEEECCEEEEEE--CCCCCHHHHHHHHHH
T ss_conf             9999-98654487-5----755786548------278742785299899998--899783999999999