HHsearch alignment for GI: 254780506 and conserved domain: PRK06719

>PRK06719 precorrin-2 dehydrogenase; Validated.
Probab=95.44  E-value=0.035  Score=36.05  Aligned_cols=60  Identities=17%  Similarity=0.242  Sum_probs=45.3

Q ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEECCCC-CCCH--------------HHHHHHCCEEEEECCCCCC
Q ss_conf             77200128996164420346899998620453312467-6534--------------7764223573652244321
Q gi|254780506|r  157 CDLSGQHAVVIGRSNLFGKPMGQLLLSRNATVTMAHSK-TKNL--------------PEICRTADILVVAVGRPRM  217 (306)
Q Consensus       157 i~l~Gk~vvVvGrs~~VG~Pla~lL~~~~atVti~hs~-T~~l--------------~~~~~~ADivIsAvG~p~~  217 (306)
T Consensus         9 l~l~~k~vLVvGGG~-VA~rK~~~Ll~~ga~VtVvsp~~~~el~~l~~i~~~~r~~~~~dl~~~~lViaATdd~~l   83 (157)
T PRK06719          9 FNLHNKVVVIIGGGK-IAYRKASGLKDTGAFVTVVSPEICEEMKELPYITWKQKTFSNDDIKDAHLIYAATNQHAV   83 (157)
T ss_pred             EECCCCEEEEECCCH-HHHHHHHHHHHCCCEEEEECCCCCHHHHHCCCEEEECCCCCHHHHCCCEEEEECCCCHHH
T ss_conf             975998799988989-999999999878796999999868999845570887046784683784399986899899