HHsearch alignment for GI: 254780506 and conserved domain: PRK06841

>PRK06841 short chain dehydrogenase; Provisional.
Probab=91.65  E-value=0.24  Score=30.17  Aligned_cols=72  Identities=18%  Similarity=0.114  Sum_probs=37.0

Q ss_pred             HHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHH-HHHHHHHCCCEEECCCCCCCHHHHHHHCCEEEEECCCCCCCCCCCC
Q ss_conf             999999998678772001289961644203468-9999862045331246765347764223573652244321220104
Q gi|254780506|r  145 AGAILLIEQFKGCDLSGQHAVVIGRSNLFGKPM-GQLLLSRNATVTMAHSKTKNLPEICRTADILVVAVGRPRMVQVDWI  223 (306)
Q Consensus       145 ~av~~ll~~y~~i~l~Gk~vvVvGrs~~VG~Pl-a~lL~~~~atVti~hs~T~~l~~~~~~ADivIsAvG~p~~i~~~~v  223 (306)
T Consensus       129 ~~~~~~m~~~-~---~G~IInisS~~~~~~~~~~~~Y~asKaav~----~ltrslA~ela~~gIrVNaV-aPG~i~T~~~  199 (255)
T PRK06841        129 QAVGRHMIAA-G---GGKIVNLASQAGVVALERHVAYCASKAGVV----GMTKVLALEWGPHGITVNAI-SPTVVLTELG  199 (255)
T ss_pred             HHHHHHHHHC-C---CCEEEEEECHHHCCCCCCCHHHHHHHHHHH----HHHHHHHHHHHHCCEEEEEE-EECCCCCCHH
T ss_conf             9999999982-9---965999946665668998588999999999----99999999970309599998-5388977034


Q ss_pred             CC
Q ss_conf             76
Q gi|254780506|r  224 KT  225 (306)
Q Consensus       224 k~  225 (306)
T Consensus       200 ~~  201 (255)
T PRK06841        200 KK  201 (255)
T ss_pred             HH
T ss_conf             33